ANXA8 Polyclonal antibody 33144-1-AP proteintech
$149.00
In stock
SKU
33144-1-AP
| Catalog Number | 33144-1-AP |
| Synonyms | Annexin A8, Annexin VIII, Annexin-8, ANX8, VAC-beta |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Calu-1 cells, HeLa cells, mouse skin tissue, rat skin tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:3000-1:8000 |
| Positive WB detected in | Calu-1 cells, HeLa cells, mouse skin tissue, rat skin tissue |
| Western Blot (WB) | WB : 1:3000-1:8000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag39741 Product name: Recombinant human ANXA8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-188 aa of BC073755 Sequence: DLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYA Predict reactive species |
| Full Name | annexin A8 |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC073755 |
| Gene Symbol | ANXA8 |
| Gene ID (NCBI) | 653145 |
| RRID | AB_3742869 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P13928 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for ANXA8 antibody 33144-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:3000-1:8000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Annexin A8 (ANXA8) gene, a member of the annexin family, encodes an anticoagulant protein involved in blood coagulation cascade and acts as an indirect inhibitor of the thromboplastin-specific complex. ANXA8 promotes the proliferation of endometrial cells through the Akt signalling pathway (PMID: 30040162). The expression levels of multiple cellular factors, including EGFR, PI3K, Akt, mTOR, p70S6K and 4EBP1, in the epidermal growth factor receptor (EGFR) signaling pathway were also altered by ANXA8 knockdown or overexpression in A549 cells, which confirmed the activation of the EGFR/Akt/mTOR signaling pathway by ANXA8 (PMID: 34671007). Protocols Product Specific Protocols WB protocol for ANXA8 antibody 33144-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
