TRPM8 Polyclonal antibody 12813-1-AP proteintech
$149.00
In stock
SKU
12813-1-AP
| Catalog Number | 12813-1-AP |
| Synonyms | LTrpC 6, LTrpC6, LTrpC-6, Trp p8, TRPP8 |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, canine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Applications | IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human prostate cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | SH-SY5Y cells |
| Tested Applications — Positive FC (Intra) detected in | A549 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive IHC detected in | human liver cancer tissue, human prostate cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
| Positive FC (Intra) detected in | A549 cells |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, canine |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3483 Product name: Recombinant human TRPM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-192 aa of BC001135 Sequence: SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC Predict reactive species |
| Full Name | transient receptor potential cation channel, subfamily M, member 8 |
| Calculated Molecular Weight | 1104 aa, 128 kDa |
| GenBank Accession Number | BC001135 |
| Gene Symbol | TRPM8 |
| Gene ID (NCBI) | 79054 |
| RRID | AB_2877883 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z2W7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for TRPM8 antibody 12813-1-AP | Download protocol |
| IF protocol for TRPM8 antibody 12813-1-AP | Download protocol |
| IHC protocol for TRPM8 antibody 12813-1-AP | Download protocol |
| mouse | IHC,IF J Dermatol Sci The temperature-sensitive receptors TRPV4 and TRPM8 have important roles in the pruritus of rosacea Authors - Xiyuan Zhou View Article |
| canine | WB,IHC,IF Reprod Biol Cryptorchidism-induced disruption of TRPM8 expression and calcium signaling in canine testes: A potential mechanism for tumourigenesis Authors - Anna Gałuszka View Article |
| mouse,human | IHC Cancer Gene Ther TRPM8 promotes hepatocellular carcinoma progression by inducing SNORA55 mediated nuclear-mitochondrial communication Authors - Jie Fu View Article |
| Citations | 8 |
| Dilutions | IHC : 1:50-1:500 IF/ICC : 1:10-1:100 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TRPM8, also known as CMR1 (cold-menthol receptor-1), is a nonselective cation channel activated by cold and the cooling substances menthol and icilin (PMID: 11893340; 11882888). It serves as a neuronal sensor of cold temperatures. Functioning TRPM8 channels are required for behavioral responses to innocuous cool, noxious cold, injury-evoked cold hypersensitivity, and cooling-mediated analgesia (PMID: 17538622; 21438154; 16920620; 21984952). Additionally, TRPM8 has also been reported to be involved in thermoregulation and the regulation of basal tear flow (PMID: 21407809; 21076394). TRPM8 is expressed extensively in sensory nerves, human prostate and overexpressed in a variety of cancers including prostate, breast, lung, colon and skin melanomas (PMID: 11325849; 20816009). Protocols Product Specific Protocols FC protocol for TRPM8 antibody 12813-1-AP Download protocol IF protocol for TRPM8 antibody 12813-1-AP Download protocol IHC protocol for TRPM8 antibody 12813-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Role of molybdenum in material immunomodulation and periodontal wound healing: Targeting immunometabolism and mitochondrial function for macrophage modulation.
Journal: Biomaterials | Authors: Xiao-Tao He | Species: mouse | Application: IF - Cold Stimuli Facilitate Inflammatory Responses Through Transient Receptor Potential Melastatin 8 (TRPM8) in Primary Airway Epithelial Cells of Asthmatic Mice.
Journal: Inflammation | Authors: Haipei Liu | Species: mouse | Application: IF - IL-33/ST2 drives inflammatory pain via CCL2 signaling and activation of TRPV1 and TRPM8
Journal: Commun Biol | Authors: Linjie Wang | Species: mouse | Application: IF - Cryptorchidism-induced disruption of TRPM8 expression and calcium signaling in canine testes: A potential mechanism for tumourigenesis
Journal: Reprod Biol | Authors: Anna Gałuszka | Species: canine | Application: WB,IHC,IF - TRPM8 promotes hepatocellular carcinoma progression by inducing SNORA55 mediated nuclear-mitochondrial communication
Journal: Cancer Gene Ther | Authors: Jie Fu | Species: mouse,human | Application: IHC - The temperature-sensitive receptors TRPV4 and TRPM8 have important roles in the pruritus of rosacea
Journal: J Dermatol Sci | Authors: Xiyuan Zhou | Species: mouse | Application: IHC,IF - Optimization and Calibration of 384-well Kinetic Ca2+ Mobilization Assays for the Human Transient Receptor Potential Cation Channels TRPM8, TRPV1, and TRPA1
Journal: SLAS Discov | Authors: David A Close | Species: human | Application: IF - Cryptorchidism-induced disruption of TRPM8 expression and calcium signaling in canine testes: A potential mechanism for tumourigenesis
Journal: Reprod Biol | Authors: Anna Gałuszka | Species: canine | Application: WB,IHC,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
