Gamma Tubulin Polyclonal antibody 15176-1-AP proteintech
$149.00
In stock
SKU
15176-1-AP
| Catalog Number | 15176-1-AP |
| Synonyms | TUBG1, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1, TUBG |
| Host | Rabbit |
| Reactivity | human, mouse, rat, canine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, Transfected HEK-293 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, Transfected HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7070 Product name: Recombinant human tubulin-gamma protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC000619 Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2878113 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IF protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IHC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IP protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| WB protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| human | WB Elife LUZP1, a novel regulator of primary cilia and the actin cytoskeleton, is a contributing factor in Townes-Brocks Syndrome. Authors - Laura Bozal-Basterra View Article |
| mouse | WB Cell Death Differ Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina. Authors - Zhigang Li View Article |
| Deng (Verified Customer) (07-22-2022) | The cells were fixed with cold methanol. Applications: Immunofluorescence Primary Antibody Dilution: 1 : 500 Cell Tissue Type: Human RPE1 cells Gamma Tubulin Antibody Immunofluorescence validation (1 : 500 dilution) in Human RPE1 cells (Cat no:15176-1-AP) |
| Iru (Verified Customer) (06-17-2021) | It works well with O/N incubation. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Fallopian tube epithelial cells Gamma Tubulin Antibody Western Blot validation (1:1000 dilution) in Fallopian tube epithelial cells (Cat no:15176-1-AP) |
| Christopher (Verified Customer) (07-02-2019) | Very fast delivery I think it arrived in a matter of days which is quick compared to some other companies.Westerns worked really well, so it must be good, over all really pleased with this purchase Applications: Western Blot, |
| Boyan (Verified Customer) (01-29-2019) | Excellent. Works quite well both for WB and IF. Applications: Western Blot, Immunofluorescence, |
| Citations | 29 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure. Protocols Product Specific Protocols FC protocol for Gamma Tubulin antibody 15176-1-AP Download protocol IF protocol for Gamma Tubulin antibody 15176-1-AP Download protocol IHC protocol for Gamma Tubulin antibody 15176-1-AP Download protocol IP protocol for Gamma Tubulin antibody 15176-1-AP Download protocol WB protocol for Gamma Tubulin antibody 15176-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Hippo Signaling Suppresses Cell Ploidy and Tumorigenesis through Skp2.
Journal: Cancer Cell | Authors: Shihao Zhang | Species: human | Application: IF - INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex
Journal: Nat Commun | Authors: Lauren G. Mascibroda | Species: human | Application: WB,IF - Noncoding RNA Ginir functions as an oncogene by associating with centrosomal proteins.
Journal: PLoS Biol | Authors: Suchismita Panda | Species: mouse | Application: IF - Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina.
Journal: Cell Death Differ | Authors: Zhigang Li | Species: mouse | Application: WB - NL13, a novel curcumin analogue and polo like kinase 4 inhibitor, induces cell cycle arrest and apoptosis in prostate cancer models
Journal: Br J Pharmacol | Authors: Xinyi Qiao | Species: human | Application: IF - LUZP1, a novel regulator of primary cilia and the actin cytoskeleton, is a contributing factor in Townes-Brocks Syndrome.
Journal: Elife | Authors: Laura Bozal-Basterra | Species: human | Application: WB - Noncoding RNA Ginir functions as an oncogene by associating with centrosomal proteins.
Journal: PLoS Biol | Authors: Suchismita Panda | Species: mouse | Application: IF - Proteome of oocyte spindle identifies Ccdc69 regulates spindle assembly like "band-tightening spell"
Journal: Cell Mol Life Sci | Authors: Jia-Ni Guo | Application: IF - Microscopy Nodes: versatile 3D microscopy visualization with Blender.
Journal: EMBO Rep | Authors: Aafke Gros | Species: human | Application: IF - LUZP1 Controls Cell Division, Migration and Invasion Through Regulation of the Actin Cytoskeleton.
Journal: Front Cell Dev Biol | Authors: Laura Bozal-Basterra | Species: mouse | Application: IHC - Echinoderm Microtubule Associated Protein Like 1 Is Indispensable for Oocyte Spindle Assembly and Meiotic Progression in Mice.
Journal: Front Cell Dev Biol | Authors: Hong Yin | Application: WB,IF - Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts.
Journal: Sci Rep | Authors: Ramona Jühlen | Species: human | Application: IF - NFYA-Mediated TTK Up-Regulation Drives Fast Cell Cycle Progression and Its Inhibition Leads to Mitotic Catastrophe in Triple Negative Breast Cancer.
Journal: Cancers (Basel) | Authors: Nianqiu Liu | Species: human | Application: IF - Whole-exome sequencing identified novel variants in CPLANE1 that causes oral-facial-digital syndrome Ⅵ by inducing primary cilia abnormality.
Journal: J Cell Mol Med | Authors: Wen Qian | Species: mouse | Application: IF - TRIM10β upregulation promotes microtubule destabilization and triggers proteotoxic stress.
Journal: Cell Signal | Authors: Heesoo Kim | Species: human | Application: IP - West Nile virus and Zika virus infections induce aggresome formation in human neural progenitor and A549 cells.
Journal: J Virol | Authors: Mausumi Basu | Species: human | Application: IF - TuBG1 promotes hepatocellular carcinoma via ATR/P53-apoptosis and cycling pathways
Journal: Hepatobiliary Pancreat Dis Int | Authors: Yan Zhang | Species: human | Application: WB,IHC - Retromer/WASH dependent sorting of nutrient transporters requires a multivalent interaction network with ANKRD50.
Journal: J Cell Sci | Authors: Arunas Kvainickas | Species: human | Application: WB - Subtype-Selective Positive Modulation of KCa2.3 Channels Increases Cilia Length
Journal: ACS Chem Biol | Authors: Young-Woo Nam | Species: mouse | Application: IF - Screening of co-pathogenic genes of non-alcoholic fatty liver disease and hepatocellular carcinoma
Journal: Front Oncol | Authors: Ting Chen | Species: human | Application: IHC - GATAD2B regulates spindle assembly by affecting protein deacetylation during oocyte meiotic maturation.
Journal: Anim Biosci | Authors: Qian Xu | Species: mouse | Application: IF - Nearly complete deletion of BubR1 causes microcephaly through shortened mitosis and massive cell death.
Journal: Hum Mol Genet | Authors: Ambrosia J Simmons | Species: mouse | Application: IF - siRNA-Mediated BmAurora B Depletion Impedes the Formation of Holocentric Square Spindles in Silkworm Metaphase BmN4 Cells
Journal: Insects | Authors: Bing Zhang | Application: IF - NUSAP1 regulates mouse oocyte meiotic maturation
Journal: J Cell Biochem | Authors: Lina Yu | Species: mouse | Application: WB,IF - Hypoxia-Inducible Factor-2alpha Affects the MEK/ERK Signaling Pathway via Primary Cilia in Connection with the Intraflagellar Transport Protein 88 Homolog
Journal: Mol Cell Biol | Authors: Tristan Leu | Species: mouse | Application: IF - Down-regulation of Polo-like kinase 4 (PLK4) induces G1 arrest via activation of the p38/p53/p21 signaling pathway in bladder cancer.
Journal: FEBS Open Bio | Authors: Ziyi Yang | Species: human | Application: IF - SHCBP1 Overexpression Aggravates Pancreatitis by Triggering the Loss of Primary Cilia
Journal: DNA Cell Biol | Authors: Lianshun Li | Species: human | Application: IF - LUZP1, a novel regulator of primary cilia and the actin cytoskeleton, is a contributing factor in Townes-Brocks Syndrome.
Journal: Elife | Authors: Laura Bozal-Basterra | Species: human | Application: WB - CRB3 navigates Rab11 trafficking vesicles to promote γTuRC assembly during ciliogenesis
Journal: Elife | Authors: Bo Wang | Species: mouse,human | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
