CoraLite® Plus 647 Anti-Human TWEAKR/CD266 Rabbit Recombinant Antibody CL647-98125 proteintech
$175.00
In stock
SKU
CL647-98125
| Catalog Number | CL647-98125 |
| Synonyms | CD266, TNFRSF12A, TweakR, 240991C5, APO3L |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, BSA |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | HT-1080 cells |
| Positive FC detected in | HT-1080 cells |
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 12A |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| GenBank Accession Number | BC002718 |
| Gene Symbol | TWEAKR |
| Gene ID (NCBI) | 51330 |
| RRID | AB_3748745 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NP84 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL Plus 647 TWEAKR/CD266 antibody CL647-98125 | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240991C5 |
| Conjugation | CoraLite® Plus 647 |
TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TWEAKR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TWEAKR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185) Protocols Product Specific Protocols FC protocol for CL Plus 647 TWEAKR/CD266 antibody CL647-98125 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
