Mouse Tslp Recombinant monoclonal antibody, PBS Only (Detector) 85623-2-PBS proteintech
$699.00
In stock
SKU
85623-2-PBS
| Catalog Number | 85623-2-PBS |
| Synonyms | Thymic stroma-derived lymphopoietin, Thymic stromal lymphopoietin |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3312 Product name: Recombinant Mouse TSLP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-140 aa of NM_021367.2 Sequence: YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE Predict reactive species |
| Full Name | thymic stromal lymphopoietin |
| Calculated Molecular Weight | 16KD |
| GenBank Accession Number | NM_021367.2 |
| Gene Symbol | Tslp |
| Gene ID (NCBI) | 53603 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9JIE6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242914A9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
