UBC12 Polyclonal antibody 14520-1-AP proteintech
$149.00
In stock
SKU
14520-1-AP
| Catalog Number | 14520-1-AP |
| Synonyms | UBE2M, EC:2.3.2.34, hUbc12, NEDD8 carrier protein, NEDD8 conjugating enzyme Ubc12 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293T cells, L02 cells, SMMC-7721 cells, HEK-293 cells, Ramos cells |
| Tested Applications — Positive IP detected in | L02 cells |
| Tested Applications — Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | L02 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | HEK-293T cells, L02 cells, SMMC-7721 cells, HEK-293 cells, Ramos cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | L02 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5984 Product name: Recombinant human UBC12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-183 aa of BC058924 Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Predict reactive species |
| Full Name | ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC058924 |
| Gene Symbol | UBC12 |
| Gene ID (NCBI) | 9040 |
| RRID | AB_2878063 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61081 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for UBC12 antibody 14520-1-AP | Download protocol |
| IHC protocol for UBC12 antibody 14520-1-AP | Download protocol |
| IP protocol for UBC12 antibody 14520-1-AP | Download protocol |
| WB protocol for UBC12 antibody 14520-1-AP | Download protocol |
| human | IF Pharmacol Res Orlistat targets NEDD8 conjugating enzyme UBC12 for cancer therapy. Authors - Mengzhen Shen View Article |
| mouse,human | WB,IP Adv Sci (Weinh) Neddylation Targets and Stabilizes NLRP3 to Augment Inflammasome-Mediated Colitis and Mood Disorder. Authors - Wenbin Gai View Article |
| human, mouse | WB,IF Cell Death Dis UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence. Authors - Yunhao Chang KO Validated View Article |
| Maria (Verified Customer) (02-06-2018) | I tested a free sample of this antibody.No non-specific bands.Load 40ug of protein for a well (15 well comb)I wish I could use a higher dilution of the antibody. Applications: Western Blot, Primary Antibody Dilution: 1:250-1:500 Cell Tissue Type: EpH4 mammary gland cell line UBC12 Antibody Western Blot, validation (1:250-1:500 dilution) in EpH4 mammary gland cell line (Cat no:14520-1-AP) |
| Citations | 21 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- A potent small-molecule inhibitor of the DCN1-UBC12 interaction that selectively blocks cullin 3 neddylation.
Journal: Nat Commun | Authors: Haibin Zhou | Species: human | Application: WB,IF - Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy
Journal: J Exp Clin Cancer Res | Authors: Bowen Zheng | Species: human | Application: IHC - Neddylation Targets and Stabilizes NLRP3 to Augment Inflammasome-Mediated Colitis and Mood Disorder.
Journal: Adv Sci (Weinh) | Authors: Wenbin Gai | Species: mouse,human | Application: WB,IP - CUL4 E3 ligase regulates the proliferation and apoptosis of lung squamous cell carcinoma and small cell lung carcinoma.
Journal: Cancer Biol Med | Authors: Ting Li | Species: human | Application: WB - Orlistat targets NEDD8 conjugating enzyme UBC12 for cancer therapy.
Journal: Pharmacol Res | Authors: Mengzhen Shen | Species: human | Application: IF - UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence.
Journal: Cell Death Dis | Authors: Yunhao Chang KO Validated | Species: human, mouse | Application: WB,IF - Orlistat targets NEDD8 conjugating enzyme UBC12 for cancer therapy.
Journal: Pharmacol Res | Authors: Mengzhen Shen | Species: human | Application: IF - UBE2M promotes malignant phenotypes of prostate cancer through mediating NAA10 neddylation.
Journal: J Transl Med | Authors: Qixia Wang | Species: human | Application: WB,IF - UBE2M inhibits neoplastic cell proliferation via MKK7-JNK-EGR1 axis in melanoma.
Journal: J Transl Med | Authors: Linlin Xu | Species: human | Application: WB,IF - Camk2n1 deficiency reduces the NaCl cotransporter activity through the CUL3/KLHL3/WNK4 complex in the kidney
Journal: Eur J Pharmacol | Authors: Ya Zhang | Species: mouse,human | Application: WB,IF - Neddylation signaling inactivation by tetracaine hydrochloride suppresses cell proliferation and alleviates vemurafenib-resistance of melanoma
Journal: Cell Biol Toxicol | Authors: Xiang Huang | Species: human | Application: WB - Regulation of UBC12 expression and protein neddylation by PINK1 suggests a primate-specific function.
Journal: Zool Res | Authors: Wei Huang | Species: monkey | Application: WB - Mitoxantrone attenuates lipopolysaccharide-induced acute lung injury via inhibition of NEDD8 activating enzyme
Journal: Int Immunopharmacol | Authors: Haiying Liu | Species: mouse | Application: WB - Proapoptotic effect of WS-299 induced by NOXA accumulation and NRF2-counterbalanced oxidative stress damage through targeting RBX1-UBE2M interaction in gastric cancers
Journal: Bioorg Chem | Authors: Ting Ma | Species: human | Application: WB - UBOX5 Modulates the Cognitive Dysfunction by Degrading HSP70 Protein in Sleep-Deprived Mice.
Journal: ACS Chem Neurosci | Authors: Guoshao Zhu - UBE2M-mediated EGFR neddylation drives keratinocyte proliferation in psoriasis.
Journal: iScience | Authors: Xiang Lin | Species: human | Application: WB,IHC - Neddylation inhibition sensitizes gastric cancer to 5-fluorouracil by targeting the post-translational stability of the metabolic enzyme dihydropyrimidine dehydrogenase.
Journal: Drug Metab Dispos | Authors: Qianqian Zhang - NPRL2 reduces the niraparib sensitivity of castration-resistant prostate cancer via interacting with UBE2M and enhancing neddylation.
Journal: Exp Cell Res | Authors: Xin Zhao | Species: human | Application: WB,IHC,IF - Disruption of protein neddylation with MLN4924 attenuates paclitaxel-induced apoptosis and microtubule polymerization in ovarian cancer cells.
Journal: Biochem Biophys Res Commun | Authors: Xiaoling Hong | Species: human | Application: WB - Evaluation of HZX-960, a novel DCN1-UBC12 interaction inhibitor, as a potential antifibrotic compound for liver fibrosis.
Journal: Biochem Cell Biol | Authors: Wenjuan Zhou | Species: human | Application: WB - Genome-wide CRISPR screen identifies noncanonical NF-κB signaling as a regulator of density-dependent proliferation.
Journal: Elife | Authors: Maria Fomicheva | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
