APAF1 Polyclonal antibody 29022-1-AP proteintech
$149.00
In stock
SKU
29022-1-AP
| Catalog Number | 29022-1-AP |
| Synonyms | APAF 1, APAF1, CED4, DKFZp781B1145, KIAA0413 |
| Host | Rabbit |
| Reactivity | Human and More (3) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | COLO 320 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Positive WB detected in | COLO 320 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30606 Product name: Recombinant human APAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 978-1110 aa of BC136532 Sequence: FGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAK Predict reactive species |
| Full Name | apoptotic peptidase activating factor 1 |
| Calculated Molecular Weight | 1248 aa, 142 kDa |
| Observed Molecular Weight | 130-140 kDa |
| GenBank Accession Number | BC136532 |
| Gene Symbol | APAF1 |
| Gene ID (NCBI) | 317 |
| RRID | AB_2923588 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14727 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for APAF1 antibody 29022-1-AP | Download protocol |
| human | WB BMC Cancer LncRNA EGFR-AS1 inhibits ferroptosis to reduce radiosensitivity of cervical cancer through the m6A/IGF2BP3/APAF1 axis. Authors - Xianglong Chen KD Validated View Article |
| mouse | WB J Agric Food Chem Polystyrene Microplastics Induced Hepatocytes Pyroptosis, Apoptosis and Ferroptosis via GSDMD-N-Mediated Mitochondrial Damage. Authors - Yuelin Chen View Article |
| rat | WB Nutrients Diosgenin Ameliorated Type II Diabetes-Associated Nonalcoholic Fatty Liver Disease through Inhibiting De Novo Lipogenesis and Improving Fatty Acid Oxidation and Mitochondrial Function in Rats Authors - Yujie Zhong View Article |
| Citations | 10 |
| Dilutions | WB : 1:1000-1:6000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
APAF1, also named as Apoptotic protease-activating factor 1 or KIAA0413, is a 1248 amino acid protein, which contains one CARD domain, contains one NB-ARC domain and Contains fifteen WD repeats. APAF1 localizes in the cytoplasm and is widely expressed in many tissues. Highest levels of expression is in adult spleen, peripheral blood leukocytes, in fetal brain, kidney and lung. Oligomeric APAF1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. Protocols Product Specific Protocols WB protocol for APAF1 antibody 29022-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Sodium citrate targeting Ca2+/CAMKK2 pathway exhibits anti-tumor activity through inducing apoptosis and ferroptosis in ovarian cancer
Journal: J Adv Res | Authors: Yulun Wu | Species: human | Application: WB - Efferocytosis by Macrophages Attenuates Inflammatory Responses Following Ultraviolet B-Induced Apoptosis in Corneal Stromal Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Seung Hyeun Lee | Species: human | Application: WB - Polystyrene Microplastics Induced Hepatocytes Pyroptosis, Apoptosis and Ferroptosis via GSDMD-N-Mediated Mitochondrial Damage.
Journal: J Agric Food Chem | Authors: Yuelin Chen | Species: mouse | Application: WB - GJB2 c.109G > A mutation activating IFI27-mediated mitochondrial apoptosis pathway leading to hereditary non-syndromic hearing loss.
Journal: Sci Rep | Authors: Yao Chen | Species: human | Application: WB - LncRNA EGFR-AS1 inhibits ferroptosis to reduce radiosensitivity of cervical cancer through the m6A/IGF2BP3/APAF1 axis.
Journal: BMC Cancer | Authors: Xianglong Chen KD Validated | Species: human | Application: WB - Diosgenin Ameliorated Type II Diabetes-Associated Nonalcoholic Fatty Liver Disease through Inhibiting De Novo Lipogenesis and Improving Fatty Acid Oxidation and Mitochondrial Function in Rats
Journal: Nutrients | Authors: Yujie Zhong | Species: rat | Application: WB - Efferocytosis by Macrophages Attenuates Inflammatory Responses Following Ultraviolet B-Induced Apoptosis in Corneal Stromal Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Seung Hyeun Lee | Species: human | Application: WB - Oxymatrine Alleviates Cerebral Ischemia/Reperfusion Injury By Targeting HDAC1 to Regulate Mitochondria-Related Autophagy and Oxidative Stress.
Journal: Mol Neurobiol | Authors: Chang-Sheng Ma | Species: mouse | Application: IF - GJB2 c.109G > A mutation activating IFI27-mediated mitochondrial apoptosis pathway leading to hereditary non-syndromic hearing loss.
Journal: Sci Rep | Authors: Yao Chen | Species: human | Application: WB - LncRNA EGFR-AS1 inhibits ferroptosis to reduce radiosensitivity of cervical cancer through the m6A/IGF2BP3/APAF1 axis.
Journal: BMC Cancer | Authors: Xianglong Chen | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
