UBQLN4 Polyclonal antibody 29413-1-AP proteintech
$149.00
In stock
SKU
29413-1-AP
| Catalog Number | 29413-1-AP |
| Synonyms | A1U, C1orf6, CIP75, UBIN, ubiquilin 4, UBQLN4 |
| Host | Rabbit |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | BGC-823 cells, BxPC-3 cells, HeLa cells, MKN-45 cells |
| Tested Applications — Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | BGC-823 cells, BxPC-3 cells, HeLa cells, MKN-45 cells |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | Human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29658 Product name: Recombinant human UBQLN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-186 aa of BC063841 Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ Predict reactive species |
| Full Name | ubiquilin 4 |
| Calculated Molecular Weight | 601 aa, 64 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC063841 |
| Gene Symbol | UBQLN4 |
| Gene ID (NCBI) | 56893 |
| RRID | AB_3086129 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRR5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for UBQLN4 antibody 29413-1-AP | Download protocol |
| WB protocol for UBQLN4 antibody 29413-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:3000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Ubiquilins (UBQLNs) are important factors for cell proteostasis maintenance. UBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis. Protocols Product Specific Protocols IHC protocol for UBQLN4 antibody 29413-1-AP Download protocol WB protocol for UBQLN4 antibody 29413-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
