VAChT Polyclonal antibody 27303-1-AP proteintech
$149.00
In stock
SKU
27303-1-AP
| Catalog Number | 27303-1-AP |
| Synonyms | SLC18A3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25153 Product name: Recombinant human SLC18A3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 410-501 aa of BC007765 Sequence: DVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRE Predict reactive species |
| Full Name | solute carrier family 18 (vesicular acetylcholine), member 3 |
| Calculated Molecular Weight | 532 aa, 57 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007765 |
| Gene Symbol | VAChT |
| Gene ID (NCBI) | 6572 |
| RRID | AB_3669592 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16572 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for VAChT antibody 27303-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SLC18A3 also known as VAChT, is the vesicular amine transporter family member. The SLC18A3 gene encodes a transmembrane protein that transports acetylcholine (ACh) into presynaptic secretory vesicles for release at cholinergic nerve endings in the central and peripheral nervous systems. Mutations in SLC18A3 are associated with congenital myasthenic syndrome(PMID: 27590285). The 68-70 kDa mature glycosylated form of VAChT can be detected (PMID: 14705140). Protocols Product Specific Protocols WB protocol for VAChT antibody 27303-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
