VAV2 Polyclonal antibody 21924-1-AP proteintech
$149.00
In stock
SKU
21924-1-AP
| Catalog Number | 21924-1-AP |
| Synonyms | VAV 2, VAV-2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human kidney tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:5000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16458 Product name: Recombinant human VAV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-326 aa of BC132967 Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV Predict reactive species |
| Full Name | vav 2 guanine nucleotide exchange factor |
| Calculated Molecular Weight | 839 aa, 97 kDa |
| Observed Molecular Weight | 101 kDa |
| GenBank Accession Number | BC132967 |
| Gene Symbol | VAV2 |
| Gene ID (NCBI) | 7410 |
| RRID | AB_11182283 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for VAV2 antibody 21924-1-AP | Download protocol |
| IHC protocol for VAV2 antibody 21924-1-AP | Download protocol |
| IP protocol for VAV2 antibody 21924-1-AP | Download protocol |
| WB protocol for VAV2 antibody 21924-1-AP | Download protocol |
| human | WB,IP,IF J Nanobiotechnology Proangiogenic effect and underlying mechanism of holmium oxide nanoparticles: a new biomaterial for tissue engineering Authors - Yuxiao Luo KD Validated View Article |
| Citations | 5 |
| Dilutions | WB : 1:1000-1:5000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
VAV2 is the second member of the VAV family of guanine nucleotide exchange factors (GEFs) for the Rho family of Ras-related GTPases. As a GEF, it catalyzes the conversion of Rho GTPases from an inactive GDP-bound state to an active GTP-bound state, thereby regulating critical cellular processes such as signal transduction, cytoskeletal remodeling, and cell migration. Unlike its family member VAV1, whose expression is restricted to hematopoietic cells, VAV2 is widely expressed across most tissues. It plays a particularly important role in angiogenesis, where its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Structurally, VAV2 contains Dbl homology (DH), Pleckstrin homology (PH), Src homology 2 (SH2), and Src homology 3 (SH3) domains, which are consistent with its function as both a signaling adaptor and an exchange factor. Protocols Product Specific Protocols IF protocol for VAV2 antibody 21924-1-AP Download protocol IHC protocol for VAV2 antibody 21924-1-AP Download protocol IP protocol for VAV2 antibody 21924-1-AP Download protocol WB protocol for VAV2 antibody 21924-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Mesenchymal stem cells promote endothelial progenitor cell migration, vascularization, and bone repair in tissue-engineered constructs via activating CXCR2-Src-PKL/Vav2-Rac1.
Journal: FASEB J | Authors: Zhilin Li | Species: human | Application: WB - Proangiogenic effect and underlying mechanism of holmium oxide nanoparticles: a new biomaterial for tissue engineering
Journal: J Nanobiotechnology | Authors: Yuxiao Luo KD Validated | Species: human | Application: WB,IP,IF - Vav2 is a master regulator of repair against bacterial pore-forming toxins.
Journal: Life Sci Alliance | Authors: Victor Gbenga Kayejo - VAV2-associated ncRNA network in the focal adhesion pathway is dysregulated in laryngeal squamous cell carcinoma.
Journal: Discov Oncol | Authors: Payam Mohammadi - Neutrophil extracellular traps-inspired DNA hydrogel for wound hemostatic adjuvant
Journal: Nat Commun | Authors: Rui Ye | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
