VHL Monoclonal antibody, PBS Only (Capture) 60776-4-PBS proteintech
$699.00
In stock
SKU
60776-4-PBS
| Catalog Number | 60776-4-PBS |
| Synonyms | PBS Only |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28860 Product name: Recombinant human VHL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 90-172 aa of BC058831 Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species |
| Full Name | von Hippel-Lindau tumor suppressor |
| Calculated Molecular Weight | 172 aa, 20 kDa |
| GenBank Accession Number | BC058831 |
| Gene Symbol | VHL |
| Gene ID (NCBI) | 7428 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P40337 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 3E3F3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
