VIPR1 Polyclonal antibody 14878-1-AP proteintech
$149.00
In stock
SKU
14878-1-AP
| Catalog Number | 14878-1-AP |
| Synonyms | HVR1, II, PACAP R 2, PACAP R2, PACAP type II receptor, RDC1, VAPC1, VIP R 1, VIPR, VIPR1, VIRG, VPAC1, VPCAP1R |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse small intestine tissue |
| Tested Applications — Positive IHC detected in | human kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse small intestine tissue |
| Positive IHC detected in | human kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6650 Product name: Recombinant human VIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-146 aa of BC064424 Sequence: AARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY Predict reactive species |
| Full Name | vasoactive intestinal peptide receptor 1 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC064424 |
| Gene Symbol | VIPR1 |
| Gene ID (NCBI) | 7433 |
| RRID | AB_2878089 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P32241 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for VIPR1 antibody 14878-1-AP | Download protocol |
| WB protocol for VIPR1 antibody 14878-1-AP | Download protocol |
| human | IHC PLoS One Identification of oxidative stress-responsive genes in recurrent miscarriage and their role in disease pathogenesis. Authors - Mian Wang View Article |
| mouse | WB Int Immunopharmacol The p65-LOC727924-miR-26a/KPNA3-p65 regulatory loop mediates vasoactive intestinal peptide effects on osteoarthritis chondrocytes Authors - Yusheng Li View Article |
| Citations | 2 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Identification of oxidative stress-responsive genes in recurrent miscarriage and their role in disease pathogenesis.
Journal: PLoS One | Authors: Mian Wang | Species: human | Application: IHC - The p65-LOC727924-miR-26a/KPNA3-p65 regulatory loop mediates vasoactive intestinal peptide effects on osteoarthritis chondrocytes
Journal: Int Immunopharmacol | Authors: Yusheng Li | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
