VSTM2L Monoclonal antibody, PBS Only (Capture) 60981-1-PBS proteintech
$699.00
In stock
SKU
60981-1-PBS
| Catalog Number | 60981-1-PBS |
| Synonyms | C20orf102, V-set and transmembrane domain-containing protein 2-like protein |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22362 Product name: Recombinant human VSTM2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-204 aa of BC033818 Sequence: RSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL Predict reactive species |
| Full Name | V-set and transmembrane domain containing 2 like |
| Calculated Molecular Weight | 204 aa, 22 kDa |
| GenBank Accession Number | BC033818 |
| Gene Symbol | VSTM2L |
| Gene ID (NCBI) | 128434 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q96N03 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1D11H9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
