Vpr Polyclonal antibody 51143-1-AP proteintech
$149.00
In stock
SKU
51143-1-AP
| Catalog Number | 51143-1-AP |
| Synonyms | PBS, Azide, Glycerol |
| Host | Rabbit |
| Reactivity | immunodeficiency virus 1 and More (2) |
| Reactivity | immunodeficiency virus 1, human, virus |
| Form | Liquid |
| Applications | WB, ELISA |
| Applications | ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | immunodeficiency virus 1 |
| Cited Reactivity | human, virus |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0718 Product name: Recombinant Vpr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of NP_057852 Sequence: MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASR Predict reactive species |
| Full Name | Vpr |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NP_057852 |
| RRID | AB_10695191 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| human | WB J Biol Chem HIV-1 Vpr Protein Induces Proteasomal Degradation of Chromatin-associated Class I HDACs to Overcome Latent Infection of Macrophages. Authors - Bizhan Romani View Article |
| virus | WB J Biol Chem HIV-1 Vpu induces caspase-mediated cleavage of IRF3. Authors - Sang Yoon Park KO Validated View Article |
| Citations | 16 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
This antibody recognize the VPR gene of Human immunodeficiency virus 1.
Publications
- HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1
Journal: Nat Commun | Authors: Qiong Zhang | Species: human | Application: WB - CHAF1A/B mediate silencing of unintegrated HIV-1 DNAs early in infection.
Journal: Proc Natl Acad Sci U S A | Authors: Franziska K Geis | Species: human | Application: WB - A functional conserved intronic G run in HIV-1 intron 3 is critical to counteract APOBEC3G-mediated host restriction.
Journal: Retrovirology | Authors: Marek Widera KO Validated | Application: WB - HIV-1 Vpu induces caspase-mediated cleavage of IRF3.
Journal: J Biol Chem | Authors: Sang Yoon Park KO Validated | Species: virus | Application: WB - HIV-1 Vpr enhances proteasomal degradation of MCM10 through the Cul4-DDB1[VprBP] E3 ubiquitin ligase to induce G2/M cell cycle arrest.
Journal: J Biol Chem | Authors: Bizhan Romani | Application: WB - HIV-1 Vpr Protein Induces Proteasomal Degradation of Chromatin-associated Class I HDACs to Overcome Latent Infection of Macrophages.
Journal: J Biol Chem | Authors: Bizhan Romani | Species: human | Application: WB - HIV-1 accessory protein Vpr possesses a cryptic p300-dependent transcription-promoting activity that is blocked by histone deacetylases in CD4+ T cells.
Journal: PLoS Pathog | Authors: Catherine A Lewis | Application: WB - Y RNAs are conserved endogenous RIG-I ligands across RNA virus infection and are targeted by HIV-1.
Journal: iScience | Authors: Nicolas Vabret | Species: human | Application: WB - HIV-1 Gag recruits oligomeric Vpr via two binding sites in p6, but both mature p6 and Vpr are rapidly lost upon target cell entry.
Journal: J Virol | Authors: Madushi Wanaguru | Species: human | Application: WB - HIV-1 Vpu induces caspase-mediated cleavage of IRF3.
Journal: J Biol Chem | Authors: Sang Yoon Park | Species: virus | Application: WB - HIV-1 Vpr enhances proteasomal degradation of MCM10 through the Cul4-DDB1[VprBP] E3 ubiquitin ligase to induce G2/M cell cycle arrest.
Journal: J Biol Chem | Authors: Bizhan Romani | Application: WB - A functional conserved intronic G run in HIV-1 intron 3 is critical to counteract APOBEC3G-mediated host restriction.
Journal: Retrovirology | Authors: Marek Widera | Application: WB - A functional conserved intronic G run in HIV-1 intron 3 is critical to counteract APOBEC3G-mediated host restriction.
Journal: Retrovirology | Authors: Marek Widera | Application: WB - The interferon-regulated host factor hnRNPA0 modulates HIV-1 production by interference with LTR activity, mRNA trafficking, and programmed ribosomal frameshifting
Journal: J Virol | Authors: Fabian Roesmann | Species: human | Application: WB - The transmembrane nucleoporin Nup210 weakens HIV-1 infection via modulating late events of viral nuclear import
Journal: AIDS | Authors: Lei Wang | Species: human | Application: WB - HIV-1 Vpr drives epigenetic remodeling to enhance virus transcription and latency reactivation
Journal: bioRxiv | Authors: Nicholas Saladino | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
