WDR61 Polyclonal antibody 22536-1-AP proteintech
$149.00
In stock
SKU
22536-1-AP
| Catalog Number | 22536-1-AP |
| Synonyms | REC14, Ski8, SKIC8, Superkiller complex protein 8, Superkiller complex protein 8, N-terminally processed |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, mouse liver tissue, HepG2 cells |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, mouse liver tissue, HepG2 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18443 Product name: Recombinant human WDR61 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC010080 Sequence: MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI Predict reactive species |
| Full Name | WD repeat domain 61 |
| Calculated Molecular Weight | 305 aa, 34 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC010080 |
| Gene Symbol | WDR61 |
| Gene ID (NCBI) | 80349 |
| RRID | AB_11232419 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZS3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for WDR61 antibody 22536-1-AP | Download protocol |
| IHC protocol for WDR61 antibody 22536-1-AP | Download protocol |
| IP protocol for WDR61 antibody 22536-1-AP | Download protocol |
| WB protocol for WDR61 antibody 22536-1-AP | Download protocol |
| mouse | WB Cell Death Dis UBR5 targets tumor suppressor CDC73 proteolytically to promote aggressive breast cancer. Authors - Gang Xiang View Article |
| human | WB Mol Cancer Ther Targeting the synthetic lethal relationship between FOCAD and TUT7 represents a potential therapeutic opportunity for TUT4/7 small molecule inhibitors in cancer Authors - Robinson Triboulet View Article |
| Citations | 7 |
| Dilutions | WB : 1:500-1:3000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency (refer to UniProt). Catalog#22536-1-AP is a rabbit polyclonal antibody raised against the full-length of human WDR61. The MW of this protein is 33 kDa, and this antibody specially recognises the 33 kDa protein. Protocols Product Specific Protocols IF protocol for WDR61 antibody 22536-1-AP Download protocol IHC protocol for WDR61 antibody 22536-1-AP Download protocol IP protocol for WDR61 antibody 22536-1-AP Download protocol WB protocol for WDR61 antibody 22536-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Inherited blood cancer predisposition through altered transcription elongation
Journal: Cell | Authors: Jiawei Zhao | Species: mouse | Application: WB,IP - SPT6 functions in transcriptional pause/release via PAF1C recruitment
Journal: Mol Cell | Authors: Yuki Aoi - ARF alters PAF1 complex integrity to selectively repress oncogenic transcription programs upon p53 loss
Journal: Mol Cell | Authors: Jinli Wang | Species: mouse | Application: WB - FOXA1 O-GlcNAcylation-mediated transcriptional switch governs metastasis capacity in breast cancer
Journal: Sci Adv | Authors: Yajie Liu | Species: human | Application: WB - UBR5 targets tumor suppressor CDC73 proteolytically to promote aggressive breast cancer.
Journal: Cell Death Dis | Authors: Gang Xiang | Species: mouse | Application: WB - Targeting the synthetic lethal relationship between FOCAD and TUT7 represents a potential therapeutic opportunity for TUT4/7 small molecule inhibitors in cancer
Journal: Mol Cancer Ther | Authors: Robinson Triboulet | Species: human | Application: WB - WDR61 ablation triggers R-loop accumulation and suppresses breast cancer progression
Journal: FEBS J | Authors: Yayan Hou | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
