WIPI2 Polyclonal antibody 28820-1-AP proteintech
$149.00
In stock
SKU
28820-1-AP
| Catalog Number | 28820-1-AP |
| Synonyms | ATG18B, Atg21, CGI 50, CGI50, CGI-50 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, RAW 264.7 cells |
| Tested Applications — Positive IHC detected in | human heart tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:16000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells, RAW 264.7 cells |
| Positive IHC detected in | human heart tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30505 Product name: Recombinant human WIPI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-454 aa of BC004116 Sequence: ALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD Predict reactive species |
| Full Name | WD repeat domain, phosphoinositide interacting 2 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC004116 |
| Gene Symbol | WIPI2 |
| Gene ID (NCBI) | 26100 |
| RRID | AB_2881218 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y4P8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for WIPI2 antibody 28820-1-AP | Download protocol |
| IHC protocol for WIPI2 antibody 28820-1-AP | Download protocol |
| WB protocol for WIPI2 antibody 28820-1-AP | Download protocol |
| human | WB Nat Commun Molecular bases of the interactions of ATG16L1 with FIP200 and ATG8 family proteins Authors - Xinyu Gong View Article |
| mouse | WB Autophagy TBC1D4 antagonizes RAB2A-mediated autophagic and endocytic pathways Authors - Rui Tian View Article |
| rat | IF Adv Sci (Weinh) SEC31a-ATG9a Interaction Mediates the Recruitment of COPII Vesicles for Autophagosome Formation Authors - Jiaming Nie View Article |
| Citations | 7 |
| Dilutions | WB : 1:2000-1:16000 IHC : 1:250-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
WIPI2, the mammalian homologue of the yeast ATG18 gene, plays a key role in autophagy. It binds the omegasome, a phosphatidylinositol 3-phosphate (PI3P) rich domain of the endoplasmic reticulum from which the mature autophagosome develops. Western blotting detected a 49 kDa WIPI2 band.(PMID: 30968111, PMID: 30403914) Protocols Product Specific Protocols IF protocol for WIPI2 antibody 28820-1-AP Download protocol IHC protocol for WIPI2 antibody 28820-1-AP Download protocol WB protocol for WIPI2 antibody 28820-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- COPI Vesicle Disruption Inhibits Mineralization via mTORC1-Mediated Autophagy
Journal: Int J Mol Sci | Authors: Jiaming Nie | Species: human | Application: IF - Evidence that S-phase kinase associated protein 2 (SKP2) is ubiquitinated and degraded via a Rho-related BTB domain containing 1 (RhoBTB1) and Cullin-3 mechanism in placenta.
Journal: Physiol Rep | Authors: Alina L. Tvina - TBC1D4 antagonizes RAB2A-mediated autophagic and endocytic pathways
Journal: Autophagy | Authors: Rui Tian | Species: mouse | Application: WB - Molecular bases of the interactions of ATG16L1 with FIP200 and ATG8 family proteins
Journal: Nat Commun | Authors: Xinyu Gong | Species: human | Application: WB - Vps34 sustains Treg cell survival and function via regulating intracellular redox homeostasis
Journal: Cell Death Differ | Authors: Peiran Feng | Application: WB - SEC31a-ATG9a Interaction Mediates the Recruitment of COPII Vesicles for Autophagosome Formation
Journal: Adv Sci (Weinh) | Authors: Jiaming Nie | Species: rat | Application: IF - Evidence that S-phase kinase associated protein 2 (SKP2) is ubiquitinated and degraded via a Rho-related BTB domain containing 1 (RhoBTB1) and Cullin-3 mechanism in placenta.
Journal: Physiol Rep | Authors: Alina L. Tvina
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
