CoraLite® Plus 488-conjugated WNT8A Polyclonal antibody CL488-30518 proteintech
$479.00
In stock
SKU
CL488-30518
| Catalog Number | CL488-30518 |
| Synonyms | Protein Wnt 8a, Protein Wnt 8d, WNT8A, WNT8D |
| Host | Rabbit |
| Reactivity | Human, rat |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | HCT 116 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | HCT 116 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | Human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29510 Product name: Recombinant human WNT8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-271 aa of NM_001300938 Sequence: LAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTE Predict reactive species |
| Full Name | wingless-type MMTV integration site family, member 8A |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 39-45 kDa |
| GenBank Accession Number | NM_001300938 |
| Gene Symbol | WNT8A |
| Gene ID (NCBI) | 7478 |
| RRID | AB_3672848 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H1J5 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 WNT8A antibody CL488-30518 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | CoraLite® Plus 488 |
WNT8A,also named as WNT8D, belongs to the Wnt family of secreted signaling proteins. It is a ligand for members of the frizzled family of seven transmembrane receptors. These have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8A may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Protocols Product Specific Protocols IF protocol for CL Plus 488 WNT8A antibody CL488-30518 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
