XPO5 Polyclonal antibody 28628-1-AP proteintech
$149.00
In stock
SKU
28628-1-AP
| Catalog Number | 28628-1-AP |
| Synonyms | Exp5, Exportin-5, KIAA1291, Ran-binding protein 21, RANBP21 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, K-562 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Tested Applications — Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Positive WB detected in | HEK-293 cells, HeLa cells, K-562 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24217 Product name: Recombinant human XPO5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000129 Sequence: MRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV Predict reactive species |
| Full Name | exportin 5 |
| Calculated Molecular Weight | 136 kDa |
| Observed Molecular Weight | 136 kDa |
| GenBank Accession Number | BC000129 |
| Gene Symbol | XPO5 |
| Gene ID (NCBI) | 57510 |
| RRID | AB_2881184 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HAV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for XPO5 antibody 28628-1-AP | Download protocol |
| WB protocol for XPO5 antibody 28628-1-AP | Download protocol |
| human | WB ACS Chem Biol Amyotrophic Lateral Sclerosis-Associated Mutants of SOD1 Modulate miRNA Biogenesis through Aberrant Interactions with Exportin 5 Authors - Xingyuan Chen View Article |
| Xingyuan (Verified Customer) (06-22-2023) | Quality of the antibody was good. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: 293T XPO5 Antibody Western Blot validation (1:2000 dilution) in 293T (Cat no:28628-1-AP) |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- METTL1 interacts with XPO5 to modulate pre-miRNA export.
Journal: Nucleic Acids Res | Authors: Zhongwen Cao | Species: human | Application: WB - Soybean isoflavones protect dopaminergic neurons from atrazine damage by inhibiting VPS13A to increase autophagy
Journal: Ecotoxicol Environ Saf | Authors: Peng Li - Amyotrophic Lateral Sclerosis-Associated Mutants of SOD1 Modulate miRNA Biogenesis through Aberrant Interactions with Exportin 5
Journal: ACS Chem Biol | Authors: Xingyuan Chen | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
