Glucagon Polyclonal antibody 15954-1-AP proteintech
$149.00
In stock
SKU
15954-1-AP
| Catalog Number | 15954-1-AP |
| Synonyms | GCG, GLP 2, GLP1, GLP2, glucagon, GRPP, GRPP Oxyntomodulin, OXM, Proglucagon |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Applications | IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human pancreas tissue, human small intestine tissue, mouse small intestine tissue, rat pancreas tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse pancreas tissue, human pancreas tissue, rat pancreas tissue |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:12800-1:51200 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive IHC detected in | human pancreas tissue, human small intestine tissue, mouse small intestine tissue, rat pancreas tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue, human pancreas tissue, rat pancreas tissue |
| Immunohistochemistry (IHC) | IHC : 1:12800-1:51200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8677 Product name: Recombinant human Glucagon protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC005278 Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Predict reactive species |
| Full Name | glucagon |
| Calculated Molecular Weight | 180 aa, 21 kDa |
| GenBank Accession Number | BC005278 |
| Gene Symbol | Glucagon |
| Gene ID (NCBI) | 2641 |
| RRID | AB_2878200 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Glucagon antibody 15954-1-AP | Download protocol |
| IHC protocol for Glucagon antibody 15954-1-AP | Download protocol |
| human | IF Cell Metab SARS-CoV-2 infects human pancreatic β cells and elicits β cell impairment. Authors - Chien-Ting Wu View Article |
| mouse | IHC Cell Rep Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis Authors - Ping Lu View Article |
| MALLIKARJUNA (Verified Customer) (11-07-2025) | WORKS GOOD FOR WESTERN BLOT Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: liver tissue |
| kk (Verified Customer) (11-21-2018) | very strong and specific staining in mouse pancreas tissues Applications: Immunohistochemistry, Immunofluorescence, Primary Antibody Dilution: 1:200 Cell Tissue Type: mouse islets |
| Citations | 67 |
| Dilutions | IHC : 1:12800-1:51200 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Background Glucagon is a protein cleaved from a precursor protein encoded by the GCG gene. The distinct peptides formed from this precursor include Glucagon, Glucagon-Like Peptide 1 (GLP-1), Glucagon-Like Peptide 2 (GLP-2), and oxyntomodulin. Glucagon is essential in maintaining blood glucose homeostasis and therefore has a key role in Type 1 and Type 2 diabetes. What is the molecular weight of Glucagon? 21 kDa. Glucagon is composed of 180 amino acids and is a ligand for a specific G-protein coupled receptor (GPCR). Where is it expressed? Glucagon is a hormone secreted by the pancreas, in the α cells of the islets of Langerhans (PMID: 18880761). GLP-1, GLP-2, and oxyntomodulin are secreted by gut endocrine cells of the GI tract and also by selected neurons in the brain. These secreted proteins are transported to the target organ in plasma. What is the function of glucagon? The regulation of blood glucose levels is controlled by a balance of the hormones INS and glucagon in a negative feedback loop. A drop in blood glucose, or hypoglycemia, stimulates the release of glucagon. This initiates a cascade of signals, ultimately causing the conversion of stored glycogen into free glucose in a process called glycogenolysis, which takes place in liver and muscle cells. Glucagon can also stimulate gluconeogenesis in the liver, the process of forming glucose from non-carbohydrate sources such as amino acids (PMID: 13477815). What diseases are associated with glucagon? Glucagon is key in homeostasis of blood glucose and maintaining the balance between hyperglycaemia and hypoglycemia. It is therefore important in the study of Type 1 and Type 2 diabetes mellitus, where dysfunction of the pancreatic cells leads to a deregulation of blood glucose levels (PMID: 19326096). In both forms of the disease, glucagon secretion is impaired, from too much being secreted during hyperglycaemia, to too little being released to normalize hypoglycemia (PMID: 18197838). Protocols Product Specific Protocols IF protocol for Glucagon antibody 15954-1-AP Download protocol IHC protocol for Glucagon antibody 15954-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Neuroendocrine cells orchestrate regeneration through Desert hedgehog signaling
Journal: Cell | Authors: William Kong - SARS-CoV-2 infects human pancreatic β cells and elicits β cell impairment.
Journal: Cell Metab | Authors: Chien-Ting Wu | Species: human | Application: IF - Paternal sleep deprivation induces metabolic perturbations in male offspring via altered LRP5 DNA methylation of pancreatic islets
Journal: J Pineal Res | Authors: Yi Zeng | Species: mouse | Application: IF - VAMP4 regulates insulin levels by targeting secretory granules to lysosomes
Journal: J Cell Biol | Authors: Min Li | Species: mouse | Application: IF - Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis
Journal: Cell Rep | Authors: Ping Lu | Species: mouse | Application: IHC - Ramulus Mori (Sangzhi) alkaloids enhance pancreatic β-Cell maturation and function by targeting the CD81/endoplasmic reticulum stress pathway
Journal: Phytomedicine | Authors: Nan Wu - OSGEP regulates islet β-cell function by modulating proinsulin translation and maintaining ER stress homeostasis in mice
Journal: Nat Commun | Authors: Yujie Liu | Species: mouse | Application: IF,ELISA - Unraveling the Role of MDK-SDC4 Interaction in Pancreatic Cancer-Associated New-Onset Diabetes by Single-Cell Transcriptomic Analysis
Journal: Adv Sci (Weinh) | Authors: Zengyu Feng | Species: human | Application: WB - Selenium Nanodots (SENDs) as Antioxidants and Antioxidant-Prodrugs to Rescue Islet β Cells in Type 2 Diabetes Mellitus by Restoring Mitophagy and Alleviating Endoplasmic Reticulum Stress
Journal: Adv Sci (Weinh) | Authors: Qiong Huang | Species: mouse | Application: IF - A sulfated manno-glucuronan ameliorates β-cell dysfunction in type 2 diabetes by targeting ALDH1A3.
Journal: Carbohydr Polym | Authors: Wenjing Zhang | Species: mouse | Application: IHC,IF - Inhibition of Notch activity promotes pancreatic cytokeratin 5-positive cell differentiation to beta cells and improves glucose homeostasis following acute pancreatitis.
Journal: Cell Death Dis | Authors: Xiaoyi Zhang | Application: IF - Ramulus Mori (Sangzhi) alkaloids enhance pancreatic β-Cell maturation and function by targeting the CD81/endoplasmic reticulum stress pathway
Journal: Phytomedicine | Authors: Nan Wu - SIRT6-mediated transcriptional suppression of Txnip is critical for pancreatic beta cell function and survival in mice.
Journal: Diabetologia | Authors: Kunhua Qin | Species: mouse | Application: IHC - Pancreatic β cell TRAPδ deficiency reduces insulin production but improves insulin sensitivity
Journal: Diabetes | Authors: Jiyun Guo | Species: mouse | Application: IHC,IF - Chayote pectin regulates blood glucose through the gut-liver axis: Gut microbes/SCFAs/FoxO1 signaling pathways
Journal: Food Res Int | Authors: Qing Guo | Species: mouse | Application: IF - A Chinese medical nutrition therapy diet accompanied by intermittent energy restriction alleviates type 2 diabetes by enhancing pancreatic islet function and regulating gut microbiota composition
Journal: Food Res Int | Authors: Wu Luo | Species: mouse | Application: IF - Effects of three Huanglian-derived polysaccharides on the gut microbiome and fecal metabolome of high-fat diet/streptozocin-induced type 2 diabetes mice
Journal: Int J Biol Macromol | Authors: Jiahao Wang | Species: mouse | Application: IF - aThe characteristics of glucose metabolism in the sulfonylurea receptor 1 knockout rat model.
Journal: Mol Med | Authors: Xiaojun Zhou | Species: rat | Application: IF - Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis
Journal: Cell Rep | Authors: Ping Lu | Species: mouse | Application: IHC - Paternal sleep deprivation induces metabolic perturbations in male offspring via altered LRP5 DNA methylation of pancreatic islets
Journal: J Pineal Res | Authors: Yi Zeng | Species: mouse | Application: IF - Inhibition of dynamin-related protein 1-filamin interaction improves systemic glucose metabolism
Journal: Br J Pharmacol | Authors: Yuri Kato | Species: mouse | Application: IHC - 20(S/R)-ginsenoside Rh1 improves type 2 diabetes via gut microbiota-modulated bile acid signaling and FXR/TGR5-dependent GLP-1 enhancement.
Journal: Biomed Pharmacother | Authors: Ge Gao | Species: mouse | Application: WB - E3 ligase substrate adaptor SPOP fine-tunes the UPR of pancreatic β cells
Journal: Genes Dev | Authors: Alexis U Oguh - TALK-1 channels control β cell endoplasmic reticulum Ca2+ homeostasis.
Journal: Sci Signal | Authors: Nicholas C Vierra - Fufang-zhenzhu-tiaozhi formula protects islet against injury and promotes β cell regeneration in diabetic mice
Journal: J Ethnopharmacol | Authors: Xu Chen | Species: mouse | Application: IF - A structurally distinct neutral polysaccharide from Polygonatum odoratum (Mill.) Druce improves hyperglycemia via the PI3K-AKT-GSK3β/FoxO1 signaling pathway.
Journal: J Ethnopharmacol | Authors: Lan Li | Species: mouse | Application: IF - FTZ promotes islet β-cell regeneration in T1DM mice via the regulation of nuclear proliferation factors
Journal: J Ethnopharmacol | Authors: Qin Zhong | Species: mouse | Application: IHC - CNC-bZIP protein Nrf1-dependent regulation of glucose-stimulated insulin secretion.
Journal: Antioxid Redox Signal | Authors: Hongzhi Zheng | Species: human | Application: IHC - Investigation of the role and mechanism of dapagliflozin in mitigating renal injury in rats afflicted with diabetic kidney disease
Journal: Biochem Pharmacol | Authors: Hao Wang | Species: rat | Application: IF - TALK-1 reduces delta-cell endoplasmic reticulum and cytoplasmic calcium levels limiting somatostatin secretion.
Journal: Mol Metab | Authors: Nicholas C Vierra | Species: mouse | Application: IF - Genetic activation of α-cell glucokinase in mice causes enhanced glucose-suppression of glucagon secretion during normal and diabetic states.
Journal: Mol Metab | Authors: Varun Bahl | Species: mouse | Application: IF - Weizmannia coagulans JA845 modulates glucose and lipid metabolism via the gut microbiota-bile acid axis and FXR/TGR5 signaling to enhance GLP-1 secretion.
Journal: Food Funct | Authors: Haifei Guan | Species: mouse | Application: WB,IF - Inflammatory Cytokines Impair Glucagon Expression and Secretion in Pancreatic α-Cells.
Journal: Diabetes Obes Metab | Authors: Caroline Bickelmann - VAMP4 regulates insulin levels by targeting secretory granules to lysosomes
Journal: J Cell Biol | Authors: Min Li | Species: mouse | Application: IF - Dapansutrile preserves pancreatic beta-cell function by regulating insulin vesicle membrane fusion and mitochondrial homeostasis.
Journal: Diabetes Obes Metab | Authors: Ying Wu | Species: mouse | Application: IF - Mesenchymal stromal cells ameliorate mitochondrial dysfunction in α cells and hyperglucagonemia in type 2 diabetes via SIRT1/FoxO3a signaling
Journal: Stem Cells Transl Med | Authors: Jia Song | Species: human,mouse | Application: WB,IF - Long-Term High-Fat High-Fructose Diet Induces Type 2 Diabetes in Rats through Oxidative Stress.
Journal: Nutrients | Authors: Yue Zhao | Species: rat | Application: IF - An Association between Decreased Small Intestinal RNA Modification and Disturbed Glucagon-like Peptide-1 Secretion under High-Fat Diet Stress
Journal: Nutrients | Authors: Jiang Chen | Species: mouse | Application: IF - JunD Regulates Pancreatic β-Cells Function by Altering Lipid Accumulation.
Journal: Front Endocrinol (Lausanne) | Authors: Kexin Wang | Species: human | Application: IF - Dendrobine alleviates the T2D/AD comorbidity in 3xTg-AD mice feeding high-fat diet via the Cav-1/PERK/CHOP pathways.
Journal: Eur J Pharmacol | Authors: Fengqing Xu | Species: mouse | Application: IF - RAGE deficiency obstructs high uric acid-induced oxidative stress and inflammatory response
Journal: Int Immunopharmacol | Authors: Hairong Zhao | Species: mouse | Application: IF - Ginseng extract improves pancreatic islet injury and promotes β-cell regeneration in T2DM mice
Journal: Front Pharmacol | Authors: Jianying Yin | Species: mouse | Application: IF - Berberine enhances the function of db/db mice islet β cell through GLP-1/GLP-1R/PKA signaling pathway in intestinal L cell and islet α cell
Journal: Front Pharmacol | Authors: Wenbin Wu | Species: mouse | Application: IF - HGF can reduce accumulation of inflammation and regulate glucose homeostasis in T2D mice.
Journal: J Physiol Biochem | Authors: Liting Yan | Species: mouse | Application: IHC - Intestinal bacteria translocation promotes β-cell dysfunction in DIO mice
Journal: Sci Rep | Authors: Xiang-Fang Yu | Application: IF - Prediabetic cardiomyopathy is attenuated by hypothalamic PVN oxytocin neuron activation.
Journal: J Physiol | Authors: Anna Nilsson | Species: rat | Application: IHC,IF - Thyroid hormone treatment counteracts cellular phenotypical remodeling in diabetic organs
Journal: iScience | Authors: Angelo M Lavecchia | Species: human,rat | Application: IF - Buddleoside-rich Chrysanthemum indicum L. extract modulates macrophage-mediated inflammation to prevent metabolic syndrome induced by unhealthy diet
Journal: BMC Complement Med Ther | Authors: Yiqing Zhou | Species: rat | Application: IF - cGAS-STING mediates cytoplasmic mitochondrial-DNA-induced inflammatory signal transduction during accelerated senescence of pancreatic β-cells induced by metabolic stress.
Journal: FASEB J | Authors: Huiqing Hu | Species: mouse | Application: IF - Type IIB PKA is highly expressed in β cells and controls cell proliferation via regulating Cyclin D1 expression
Journal: FEBS J | Authors: Yaojing Jiang | Species: human,mouse | Application: IF - Disrupted glucose homeostasis and skeletal muscle-specific glucose uptake in an exocyst knockout mouse model.
Journal: J Biol Chem | Authors: Brent A Fujimoto | Species: mouse | Application: IF - Small Hepatitis B Virus Surface Antigen Promotes Hepatic Gluconeogenesis via Enhancing Glucagon/cAMP/Protein Kinase A/CREB Signaling
Journal: J Virol | Authors: Yan Chen | Species: mouse | Application: IF - Hesperidin activates the GLP-1R/cAMP-CREB/IRS2/PDX1 pathway to promote transdifferentiation of islet α cells into β cells Across the spectrum
Journal: Heliyon | Authors: Wang Zhang | Species: mouse | Application: IF - The active GLP-1 analogue liraglutide alleviates H9N2 influenza virus-induced acute lung injury in mice.
Journal: Microb Pathog | Authors: Yu Bai | Application: IHC - Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells.
Journal: Mol Cell Endocrinol | Authors: Xinghong Guo | Species: mouse | Application: IF - Combined therapy of GABA and sitagliptin prevents high-fat diet impairment of beta-cell function
Journal: Mol Cell Endocrinol | Authors: Zhihong Wang | Species: mouse | Application: IHC - Mesenchymal stem cell-conditioned medium alleviates high fat-induced hyperglucagonemia via miR-181a-5p and its target PTEN/AKT signaling.
Journal: Mol Cell Endocrinol | Authors: Jia Song | Species: mouse | Application: IF - Isoastragaloside I improves hyperglycaemia and increases β-cell mass in mice.
Journal: Diabet Med | Authors: Ankang Pan | Species: mouse | Application: IHC - Mint3 is dispensable for pancreatic and kidney functions in mice.
Journal: Biochem Biophys Rep | Authors: Yoohwa Chung | Species: mouse | Application: IHC - Nfe2l1 deficiency mitigates streptozotocin-induced pancreatic β-cell destruction and development of diabetes in male mice
Journal: Food Chem Toxicol | Authors: Simeng Bao | Species: mouse | Application: IF - The potential mechanism of Liu-Wei-Di-Huang Pills in treatment of type 2 diabetic mellitus: from gut microbiota to short-chain fatty acids metabolism.
Journal: Acta Diabetol | Authors: Zi-Yang Yi | Species: rat | Application: IHC - Huanglian-Renshen-Decoction Maintains Islet β-Cell Identity in T2DM Mice through Regulating GLP-1 and GLP-1R in Both Islet and Intestine
Journal: Chin J Integr Med | Authors: Wen-Bin Wu | Species: mouse | Application: IF - Morphological and biochemical changes in the pancreas associated with acute systemic hypoxia.
Journal: Hum Cell | Authors: Fumiya Morioka | Species: human | Application: IHC - Lineage Tracing Reveals the Dynamic Contribution of Id2(+) Progenitor Cells to Branching Morphogenesis.
Journal: Stem Cells Dev | Authors: Shaoqiu Leng | Species: mouse | Application: IF - Protocol for renal subcapsular islet transplantation in diabetic mice to induce long-term immune tolerance
Journal: STAR Protoc | Authors: Yinglin Yuan | Species: mouse | Application: IF - Multifaceted secretion of htNSC-derived hypothalamic islets induces survival and antidiabetic effect via peripheral implantation in mice.
Journal: Elife | Authors: Yizhe Tang | Species: mouse | Application: IF - Multifaceted secretion of htNSC-derived hypothalamic islets induces survival and antidiabetic effect via peripheral implantation in mice.
Journal: Elife | Authors: Yizhe Tang | Species: mouse | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
