ZBTB7B Polyclonal antibody 11341-1-AP proteintech
$149.00
In stock
SKU
11341-1-AP
| Catalog Number | 11341-1-AP |
| Synonyms | ZFP67, Zfp 67, ZBTB15, THPOK, hcKrox |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, bovine, hamster |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:800-1:3200 |
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:800-1:3200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, bovine, hamster |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1888 Product name: Recombinant human ZBTB7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012070 Sequence: MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP Predict reactive species |
| Full Name | zinc finger and BTB domain containing 7B |
| Calculated Molecular Weight | 539 aa, 58 kDa |
| Observed Molecular Weight | 60-65 kDa |
| GenBank Accession Number | BC012070 |
| Gene Symbol | ZBTB7B |
| Gene ID (NCBI) | 51043 |
| RRID | AB_2217245 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15156 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ZBTB7B antibody 11341-1-AP | Download protocol |
| IP protocol for ZBTB7B antibody 11341-1-AP | Download protocol |
| WB protocol for ZBTB7B antibody 11341-1-AP | Download protocol |
| hamster | WB Acta Biomater LAP2β transmits force to upregulate genes via chromatin domain stretching but not compression Authors - Jian Sun View Article |
| mouse | WB,IHC J Nanobiotechnology Edible exosome-like nanoparticles from portulaca oleracea L mitigate DSS-induced colitis via facilitating double-positive CD4+CD8+T cells expansion Authors - Min-Zheng Zhu View Article |
| bovine | WB,IP J Agric Food Chem Acylated Ghrelin Activates PI3K/mTOR Signaling Pathway by Promoting ThPOK Acetylation to Promote Milk Fat Synthesis in Bovine Mammary Epithelial Cells Authors - Jiaxin Wang View Article |
| human | WB Oncogenesis Inhibition of ZBTB7B-mediated ADPGK transcription by NEDD4 impedes glycolysis and progression of lung adenocarcinoma. Authors - Fang-Peng Liu KD Validated View Article |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:800-1:3200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ZBTB7B belongs to a large family of transcription factors, generally acting as repressors, characterized by a carboxy-terminal DNA binding domain made of multiple zinc fingers (four in Thpok) and an amino-terminal BTB-POZ domain that mediates homo- (and possibly hetero-) dimerization [PMID: 17084908]. Zbtb7b is up-regulated by MHC-II-restricted thymocytes during their CD4 differentiation and is a major determinant of CD4 lineage choice. Two properties of ZBTB7B deserve attention. First, although Thpok is expressed in a wide variety of cells, its expression in the thymus is highly lineage-specific : CD4 SP thymocytes (and all CD4 T cells) express Thpok, whereas DP and CD8 SP thymocytes do notSecond, both loss- and gain-of-function experiments indicate that Thpok affects lineage choice but not positive selection [PMID: 15729333, 10550051]. Protocols Product Specific Protocols IF protocol for ZBTB7B antibody 11341-1-AP Download protocol IP protocol for ZBTB7B antibody 11341-1-AP Download protocol WB protocol for ZBTB7B antibody 11341-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- LAP2β transmits force to upregulate genes via chromatin domain stretching but not compression
Journal: Acta Biomater | Authors: Jian Sun | Species: hamster | Application: WB - Edible exosome-like nanoparticles from portulaca oleracea L mitigate DSS-induced colitis via facilitating double-positive CD4+CD8+T cells expansion
Journal: J Nanobiotechnology | Authors: Min-Zheng Zhu | Species: mouse | Application: WB,IHC - Acylated Ghrelin Activates PI3K/mTOR Signaling Pathway by Promoting ThPOK Acetylation to Promote Milk Fat Synthesis in Bovine Mammary Epithelial Cells
Journal: J Agric Food Chem | Authors: Jiaxin Wang | Species: bovine | Application: WB,IP - Epigenetic DNA methylation of Zbtb7b regulates the population of double-positive CD4+CD8+ T cells in ulcerative colitis.
Journal: J Transl Med | Authors: Hao-Ming Xu | Species: human | Application: WB,IHC - The critical role of BMP signaling in gastric epithelial cell differentiation revealed by organoids
Journal: Cell Regen | Authors: Fan Hong - Inhibition of ZBTB7B-mediated ADPGK transcription by NEDD4 impedes glycolysis and progression of lung adenocarcinoma.
Journal: Oncogenesis | Authors: Fang-Peng Liu KD Validated | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
