ZC3H12D Polyclonal antibody 24991-1-AP proteintech
$149.00
In stock
SKU
24991-1-AP
| Catalog Number | 24991-1-AP |
| Synonyms | MCPIP4, MCP-induced protein 4, MCP induced protein 4, FLJ46041, EC:3.1.-.- |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Raji cells, K-562 cells |
| Tested Applications — Positive IP detected in | Raji cells |
| Tested Applications — Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | Raji cells, K-562 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species |
| Full Name | zinc finger CCCH-type containing 12D |
| Calculated Molecular Weight | 527 aa, 58 kDa |
| Observed Molecular Weight | 55-58 kDa |
| GenBank Accession Number | BC157832 |
| Gene Symbol | ZC3H12D |
| Gene ID (NCBI) | 340152 |
| RRID | AB_2879834 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A2A288 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| IP protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| WB protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| human | WB Oncol Lett miR-128-3p serves as an oncogenic microRNA in osteosarcoma cells by downregulating ZC3H12D. Authors - Maoshu Zhu View Article |
| mouse | WB J Biol Chem Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation. Authors - Shengping Huang KD Validated View Article |
| Elaine (Verified Customer) (09-06-2024) | Worked very nicely in western blot. Showed one clear band of the correct size in mouse T cell lysate and appears to not have cross-reactivity with Zc3h12a. Applications: Western Blot Primary Antibody Dilution: 1:1000 in 5% BSA+TBS-T Cell Tissue Type: murine T cells |
| Citations | 7 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines. Protocols Product Specific Protocols IHC protocol for ZC3H12D antibody 24991-1-AP Download protocol IP protocol for ZC3H12D antibody 24991-1-AP Download protocol WB protocol for ZC3H12D antibody 24991-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Personalized drug screening in patient-derived organoids of biliary tract cancer and its clinical application
Journal: Cell Rep Med | Authors: Xiaoxue Ren | Species: human | Application: IHC - Extracellular mRNA transported to the nucleus exerts translation-independent function.
Journal: Nat Commun | Authors: Takeshi Tomita KO Validated | Application: WB - Integrating knowledge of protein sequence with protein function for the prediction and validation of new MALT1 substrates
Journal: Comput Struct Biotechnol J | Authors: Peter A Bell | Species: human | Application: WB - Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
Journal: J Biol Chem | Authors: Shengping Huang KD Validated | Species: mouse | Application: WB - DNA Methylation Profiling Reveals the Change of Inflammation-Associated ZC3H12D in Leukoaraiosis.
Journal: Front Aging Neurosci | Authors: Wen-Qing Huang | Species: human | Application: WB - miR-128-3p serves as an oncogenic microRNA in osteosarcoma cells by downregulating ZC3H12D.
Journal: Oncol Lett | Authors: Maoshu Zhu | Species: human | Application: WB - ZC3H12D is a prognostic biomarker associated with immune cell infiltration in lung adenocarcinoma.
Journal: Transl Cancer Res | Authors: Wangang Gong | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
