ZNF253 Polyclonal antibody 25152-1-AP proteintech
$149.00
In stock
SKU
25152-1-AP
| Catalog Number | 25152-1-AP |
| Synonyms | BMZF 1, BMZF1, Bone marrow zinc finger 1, zinc finger protein 253, Zinc finger protein 411, ZNF253, ZNF411 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, SMMC-7721 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Positive WB detected in | HepG2 cells, SMMC-7721 cells |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18570 Product name: Recombinant human ZNF253 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-130 aa of BC125063 Sequence: LTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYN Predict reactive species |
| Full Name | zinc finger protein 253 |
| Calculated Molecular Weight | 499 aa, 58 kDa |
| Observed Molecular Weight | 58-65 kDa |
| GenBank Accession Number | BC125063 |
| Gene Symbol | ZNF253 |
| Gene ID (NCBI) | 56242 |
| RRID | AB_2879927 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75346 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for ZNF253 antibody 25152-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:200-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ZNF253, also named as Zinc finger protein 411 or BMZF1, is a 499 amino acid protein, which contains one KRAB domain and eleven C2H2-type zinc fingers. ZNF253 belongs to the krueppel C2H2-type zinc-finger protein family and is expressed in bone marrow and in monocytic and immature erythroid cell lines. ZNF253 may function as a transcription factor. Protocols Product Specific Protocols WB protocol for ZNF253 antibody 25152-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
