Mouse APRIL/TNFSF13 Recombinant monoclonal antibody, PBS Only (Capture) 84789-5-PBS proteintech
$699.00
In stock
SKU
84789-5-PBS
| Catalog Number | 84789-5-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1561 Product name: Recombinant Mouse APRIL/TNFSF13 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 96-241 aa of NM_023517.2 Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 13 |
| Calculated Molecular Weight | 27kDa |
| GenBank Accession Number | NM_023517.2 |
| Gene Symbol | Tnfsf13 |
| Gene ID (NCBI) | 69583 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9D777 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241666B7 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
