ZNF846 Polyclonal antibody 24514-1-AP proteintech
$149.00
In stock
SKU
24514-1-AP
| Catalog Number | 24514-1-AP |
| Synonyms | zinc finger protein 846, ZNF846 |
| Host | Rabbit |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | C6 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | C6 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21687 Product name: Recombinant human ZNF846 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-55 aa of BC118657 Sequence: AFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECG Predict reactive species |
| Full Name | zinc finger protein 846 |
| Calculated Molecular Weight | 533 aa, 61 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC118657 |
| Gene Symbol | ZNF846 |
| Gene ID (NCBI) | 162993 |
| RRID | AB_2879584 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q147U1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for ZNF846 antibody 24514-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ZNF846 also termed as zinc finger protein 846 is a 533 amino-acid protein, which contains 1 KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF846 localizes in the nucleus and may play an important role in transcription regulation. The function of ZNF846 is still non-known and need to be further studied. Protocols Product Specific Protocols WB protocol for ZNF846 antibody 24514-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents