ZP3 Polyclonal antibody 21279-1-AP proteintech
$149.00
In stock
SKU
21279-1-AP
| Catalog Number | 21279-1-AP |
| Synonyms | Processed zona pellucida sperm-binding protein 3, Zona pellucida sperm-binding protein 3, Zp 3, Zp-3, ZP3A |
| Host | Rabbit |
| Reactivity | human, mouse and More (2) |
| Reactivity | human, mouse, pig, hamster |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, CoIP, ELISA |
| Applications | IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse ovary tissue |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:500 |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse ovary tissue |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, hamster |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15791 Product name: Recombinant human ZP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC113949 Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF Predict reactive species |
| Full Name | zona pellucida glycoprotein 3 (sperm receptor) |
| Calculated Molecular Weight | 373 aa, 41 kDa |
| Observed Molecular Weight | 47 kDa, 60 kDa |
| GenBank Accession Number | BC113949 |
| Gene Symbol | ZP3 |
| Gene ID (NCBI) | 7784 |
| RRID | AB_11124319 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21754 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IHC protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IP protocol for ZP3 antibody 21279-1-AP | Download protocol |
| mouse | IF Hum Mutat A novel gene mutation in ZP3 loop region identified in patients with empty follicle syndrome Authors - Zhiqiang Zhang View Article |
| human | IF Cell Discov Abnormal gametogenesis induced by p53 deficiency promotes tumor progression and drug resistance. Authors - Chunfang Liu View Article |
| hamster | IF Fertil Steril The critical role of ZP genes in female infertility characterized by empty follicle syndrome and oocyte degeneration. Authors - Ping Yang View Article |
| Julia (Verified Customer) (08-18-2022) | It works well. Applications: Western Blot, Immunofluorescence |
| Kathryn (Verified Customer) (04-22-2022) | This antibody works beautifully to highlight the zona pellucida on mouse ovary sections. Applications: Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: Mouse ovary sections ZP3 Antibody Immunofluorescence validation (1:100 dilution) in Mouse ovary sections (Cat no:21279-1-AP) |
| Citations | 24 |
| Dilutions | IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:200-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000). Protocols Product Specific Protocols IF protocol for ZP3 antibody 21279-1-AP Download protocol IHC protocol for ZP3 antibody 21279-1-AP Download protocol IP protocol for ZP3 antibody 21279-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Transglutaminase 2 crosslinks zona pellucida glycoprotein 3 to prevent polyspermy.
Journal: Cell Death Differ | Authors: Zhaokang Cui | Species: mouse | Application: WB,CoIP - A Recurrent Missense Mutation in ZP3 Causes Empty Follicle Syndrome and Female Infertility.
Journal: Am J Hum Genet | Authors: Tailai Chen | Species: human | Application: IHC,IF,CoIP - The critical role of ZP genes in female infertility characterized by empty follicle syndrome and oocyte degeneration.
Journal: Fertil Steril | Authors: Ping Yang | Species: hamster | Application: IF - Identification of a heterozygous variant of ZP2 as a novel cause of empty follicle syndrome in humans and mice.
Journal: Hum Reprod | Authors: Ying Shen | Species: mouse | Application: WB,IF - Abnormal gametogenesis induced by p53 deficiency promotes tumor progression and drug resistance.
Journal: Cell Discov | Authors: Chunfang Liu | Species: human | Application: IF - A novel gene mutation in ZP3 loop region identified in patients with empty follicle syndrome
Journal: Hum Mutat | Authors: Zhiqiang Zhang | Species: mouse | Application: IF - Dominant follicle-targeted nanocarriers for GH delivery to alleviate premature ovarian insufficiency
Journal: Mater Today Bio | Authors: Shao Yang | Species: mouse - The critical role of ZP genes in female infertility characterized by empty follicle syndrome and oocyte degeneration.
Journal: Fertil Steril | Authors: Ping Yang | Species: hamster | Application: IF - A Recurrent Missense Mutation in ZP3 Causes Empty Follicle Syndrome and Female Infertility.
Journal: Am J Hum Genet | Authors: Tailai Chen | Species: human | Application: IHC,IF,CoIP - Carboplatin and paclitaxel induced-gonadotoxicity on the ovarian reserve of young breast cancer patients with BRCA1 mutation
Journal: Hum Reprod | Authors: Joana Dias Nunes | Species: human | Application: IF - Identification of a heterozygous variant of ZP2 as a novel cause of empty follicle syndrome in humans and mice.
Journal: Hum Reprod | Authors: Ying Shen | Species: mouse | Application: WB,IF - A compound heterozygous mutation in ZP1 and two novel heterozygous cis mutations in ZP3 causes infertility in women presenting with empty follicle syndrome
Journal: J Ovarian Res | Authors: Xiaoxiao Wang | Species: human | Application: IF - Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles.
Journal: Sci Rep | Authors: Tomoko Kawai | Species: mouse | Application: WB,IP,IF - Effects of hyperhomocysteinemia on follicular development and oocytes quality
Journal: iScience | Authors: Lu Wang | Species: mouse | Application: WB,IHC - Lineage tracing of soma-to-primordial germ cell-like conversion in human tumor cell line.
Journal: iScience | Authors: Jing Li - Ultrastructure and inter-cellular contact-mediated communication in cultured human early stage follicles exposed to mTORC1 inhibitor.
Journal: Mol Hum Reprod | Authors: J Grosbois | Species: human | Application: IF - Intracellular fraction of zona pellucida protein 3 is required for the oocyte-to-embryo transition in mice
Journal: Mol Hum Reprod | Authors: Steffen Israel | Species: mouse | Application: WB,IF - The inhibition of WIP1 phosphatase accelerates the depletion of primordial follicles.
Journal: Reprod Biomed Online | Authors: Su Zhou | Species: mouse | Application: IF - Pre-pubertal obesity compromises ovarian oxidative stress, DNA repair and chemical biotransformation
Journal: Toxicol Appl Pharmacol | Authors: Kelsey Timme | Species: mouse | Application: IF - Transglutaminase 2 reduces the polyspermy of porcine oocytes by promoting the hardening of zona pellucida
Journal: Theriogenology | Authors: Zhaokang Cui | Species: pig | Application: WB - ZP3 promotes hepatocellular carcinoma progression via the Notch signaling pathway and is associated with the tumor microenvironment and immunotherapy response.
Journal: World J Surg Oncol | Authors: Caihao Qu | Species: human | Application: WB,IHC - Circadian regulation of mTORC1 signaling via Per2 dependent mechanism disrupts folliculogenesis and oocyte maturation in female mice
Journal: J Mol Histol | Authors: Gizem Bora | Application: IF - Hydroxychloroquine protects against autoimmune premature ovarian insufficiency by modulating the Treg/Th17 cell ratio in BALB/c mice
Journal: Am J Reprod Immunol | Authors: Ling Shuai | Species: mouse | Application: IHC - A novel gene mutation in ZP3 loop region identified in patients with empty follicle syndrome
Journal: Hum Mutat | Authors: Zhiqiang Zhang | Species: mouse | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
