ZYG11A Recombinant monoclonal antibody, PBS Only (Capture/Detector) 84806-3-PBS proteintech
$699.00
In stock
SKU
84806-3-PBS
| Catalog Number | 84806-3-PBS |
| Synonyms | Protein zyg 11 homolog A, ZYG11 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag30166 Product name: Recombinant human ZYG11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 628-696 aa of NM_001004339 Sequence: TSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYH Predict reactive species |
| Full Name | zyg-11 homolog A (C. elegans) |
| Calculated Molecular Weight | 86 kDa |
| GenBank Accession Number | NM_001004339 |
| Gene Symbol | ZYG11A |
| Gene ID (NCBI) | 440590 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6WRX3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242289E3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
