Aquaporin 4 Recombinant monoclonal antibody, PBS Only 82296-2-PBS proteintech
$699.00
In stock
SKU
82296-2-PBS
| Catalog Number | 82296-2-PBS |
| Synonyms | AQP4, AQP 4, AQP-4, Aquaporin4, Aquaporin-4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Full Name | Aquaporin 4 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| GenBank Accession Number | BC022286 |
| Gene Symbol | Aquaporin 4 |
| Gene ID (NCBI) | 361 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P55087 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240856A9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
