Recombinant human filamin-C protein Ag29481 proteintech
$199.00
In stock
SKU
Ag29481
| Formulation | The protein was expressed as 6xHis-tagged fusion protein by E.Coli and purified by Ni-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 300mM imidazole. |
| Reconstitution | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping | The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C. |
| Host / Isotype | United States |
| Peptide Sequence | PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQ (2161-2248 aa encoded by NM_001458 ) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
| Stability and Storage | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles. |
| Storage of Reconstituted Protein | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
