AMACR/p504S Monoclonal antibody 60240-1-Ig proteintech
$149.00
In stock
SKU
60240-1-Ig
| Catalog Number | 60240-1-Ig |
| Synonyms | AMACR, p504S, 2H9B5, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | HepG2 cells, PC-3 cells, HEK-293 cells, HeLa cells, LNCaP cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HepG2 cells, PC-3 cells, HEK-293 cells, HeLa cells, LNCaP cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | A431 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species |
| Full Name | alpha-methylacyl-CoA racemase |
| Calculated Molecular Weight | 382 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC009471 |
| Gene Symbol | AMACR |
| Gene ID (NCBI) | 23600 |
| RRID | AB_2881363 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UHK6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for AMACR/p504S antibody 60240-1-Ig | Download protocol |
| WB protocol for AMACR/p504S antibody 60240-1-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:6000 IF/ICC : 1:200-1:800 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2H9B5 |
| Conjugation | Unconjugated |
AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4). Protocols Product Specific Protocols IF protocol for AMACR/p504S antibody 60240-1-Ig Download protocol WB protocol for AMACR/p504S antibody 60240-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
