AMACR/p504S Recombinant monoclonal antibody, PBS Only 84891-2-PBS proteintech
$699.00
In stock
SKU
84891-2-PBS
| Catalog Number | 84891-2-PBS |
| Synonyms | AMACR, p504S, 242456D1, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species |
| Full Name | alpha-methylacyl-CoA racemase |
| Calculated Molecular Weight | 382 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC009471 |
| Gene Symbol | AMACR |
| Gene ID (NCBI) | 23600 |
| RRID | AB_3743815 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UHK6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242456D1 |
| Conjugation | Unconjugated |
AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. A mitochondrial and peroxisomal enzyme catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing and can form a dimer of 70-75 kDa(PMID:21812041). Defects in AMACR cause alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
