CoraLite® Plus 488-conjugated AMACR/p504S Monoclonal antibody CL488-60240 proteintech
$479.00
In stock
SKU
CL488-60240
| Catalog Number | CL488-60240 |
| Synonyms | AMACR, p504S, 2H9B5, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase |
| Host | Mouse |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC, FC (Intra) |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Tested Applications — Positive FC (Intra) detected in | LNCaP cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | LNCaP cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species |
| Full Name | alpha-methylacyl-CoA racemase |
| Calculated Molecular Weight | 382 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC009471 |
| Gene Symbol | AMACR |
| Gene ID (NCBI) | 23600 |
| RRID | AB_2934427 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UHK6 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 488 AMACR/p504S antibody CL488-60240 | Download protocol |
| IF protocol for CL Plus 488 AMACR/p504S antibody CL488-60240 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2H9B5 |
| Conjugation | CoraLite® Plus 488 |
AMACR(Alpha-methylacyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methylacyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4). Protocols Product Specific Protocols FC protocol for CL Plus 488 AMACR/p504S antibody CL488-60240 Download protocol IF protocol for CL Plus 488 AMACR/p504S antibody CL488-60240 Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
