p57Kip2 Polyclonal antibody 23317-1-AP proteintech
$149.00
In stock
SKU
23317-1-AP
| Catalog Number | 23317-1-AP |
| Synonyms | CDKN1C, KIP2, Cyclin-dependent kinase inhibitor 1C, Cyclin-dependent kinase inhibitor p57, p57 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, CoIP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, SH-SY5Y cells, Jurkat cells |
| Tested Applications — Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | HeLa cells, SH-SY5Y cells, Jurkat cells |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag19849 Product name: Recombinant human CDKN1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-316 aa of BC067842 Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 1C (p57, Kip2) |
| Calculated Molecular Weight | 316 aa, 32 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC067842 |
| Gene Symbol | p57 Kip2/CDKN1C |
| Gene ID (NCBI) | 1028 |
| RRID | AB_2879254 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49918 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for p57Kip2 antibody 23317-1-AP | Download protocol |
| WB protocol for p57Kip2 antibody 23317-1-AP | Download protocol |
| human | WB Oncogene Dual network analysis of transcriptome data for discovery of new therapeutic targets in non-small cell lung cancer Authors - Yuquan Bai View Article |
| Citations | 11 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life. Protocols Product Specific Protocols IHC protocol for p57Kip2 antibody 23317-1-AP Download protocol WB protocol for p57Kip2 antibody 23317-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- microRNA-221 Enhances MYCN via Targeting Nemo-like Kinase and Functions as an Oncogene Related to Poor Prognosis in Neuroblastoma.
Journal: Clin Cancer Res | Authors: Xiao-Yan He | Species: human | Application: WB - Downregulation of ALKBH5 rejuvenates aged human mesenchymal stem cells and enhances their therapeutic efficacy in myocardial infarction
Journal: FASEB J | Authors: Xiaoyan Gao | Species: human | Application: WB - PIK3R3 is upregulated in liver cancer and activates Akt signaling to control cancer growth by regulation of CDKN1C and SMC1A
Journal: Cancer Med | Authors: Weidong Lin KD Validated | Species: human | Application: WB,IHC - The FOXM1/RNF26/p57 axis regulates the cell cycle to promote the aggressiveness of bladder cancer.
Journal: Cell Death Dis | Authors: Lu Yi | Species: human | Application: WB,IHC,CoIP - FBXO42 promotes hepatocellular carcinoma progression via mediating p57Kip2 ubiquitination and degradation
Journal: Eur J Med Res | Authors: Bing Zhou | Application: WB - Dual network analysis of transcriptome data for discovery of new therapeutic targets in non-small cell lung cancer
Journal: Oncogene | Authors: Yuquan Bai | Species: human | Application: WB - FAM111B enhances glycolysis and promotes metastasis of prostate cancer by upregulating LDHA
Journal: Neoplasia | Authors: Qingliu He - Downregulation of ALKBH5 rejuvenates aged human mesenchymal stem cells and enhances their therapeutic efficacy in myocardial infarction
Journal: FASEB J | Authors: Xiaoyan Gao | Species: human | Application: WB - FBXL6 drives tumorigenesis in lung adenocarcinoma through ubiquitination and proteasomal degradation of CDKN1C.
Journal: Exp Cell Res | Authors: Guanzhong Dong | Species: human | Application: WB,IHC - PIK3R3 is upregulated in liver cancer and activates Akt signaling to control cancer growth by regulation of CDKN1C and SMC1A
Journal: Cancer Med | Authors: Weidong Lin | Species: human | Application: WB,IHC - Tributyltin affects the growth of ovarian granulosa cells in polycystic ovary syndrome by upregulating YY1-mediated CDKN1C via the PI3K/AKT pathway
Journal: Reprod Biol | Authors: Shitao Dong | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
