NF-κB p65 Polyclonal antibody 10745-1-AP proteintech
$149.00
In stock
SKU
10745-1-AP
| Catalog Number | 10745-1-AP |
| Synonyms | NF κB, p65, p65; RELA, RELA, NF Kappa B |
| Host | Rabbit |
| Reactivity | human and More (8) |
| Reactivity | human, canine, chicken, bovine, hamster, goat, fish, bombyx mori, duck |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, human colon tissue, human liver cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human colon tissue, human liver cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, canine, chicken, bovine, hamster, goat, fish, bombyx mori, duck |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC011603 |
| Gene Symbol | NF-κB p65 |
| Gene ID (NCBI) | 5970 |
| RRID | AB_2178878 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| IHC protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| IP protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| WB protocol for NF-κB p65 antibody 10745-1-AP | Download protocol |
| human | WB,IF J Hematol Oncol Lung tumor exosomes induce a pro-inflammatory phenotype in mesenchymal stem cells via NFκB-TLR signaling pathway. Authors - Xiaoxia Li View Article |
| Karthick (Verified Customer) (04-08-2026) | 1 in 1000 dilution, NFKB antibody works well Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Cell culture Primary Antibody Dilution: 1:1000 dilution Cell Tissue Type: Astrocytes and Microglia cells NF-κB p65 Antibody Western Blot,Immunohistochemistry,Immunofluorescence,Cell culture validation (1:1000 dilution dilution) in Astrocytes and Microglia cells (Cat no:10745-1-AP) |
| Mounika (Verified Customer) (03-24-2026) | Very nice antibody, good to work with it1 Applications: Western Blot, Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:1000 |
| Vignesh (Verified Customer) (11-18-2025) | Applications: Western Blot Primary Antibody Dilution: 1:500 Cell Tissue Type: THP-1 CELLS |
| Maximilian (Verified Customer) (06-30-2023) | Quite a bit of unspecific binding. Did not work in mouse cell lines. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Mainly Human Breast Cancer Cell lines (MDA-MB-436, MDA-MB-468, MDA-MB-231) |
| Xie (Verified Customer) (09-29-2022) | NF-κB p65 Antibody staining. Applications: Immunofluorescence Primary Antibody Dilution: 1:250 Cell Tissue Type: hela NF-κB p65 Antibody Immunofluorescence validation (1:250 dilution) in hela (Cat no:10745-1-AP) |
| Murali (Verified Customer) (01-24-2022) | Very nice antibody for IHC Applications: Immunohistochemistry Primary Antibody Dilution: 1 to 200 Cell Tissue Type: pharyngeal mucosal NF-κB p65 Antibody Immunohistochemistry validation (1 to 200 dilution) in pharyngeal mucosal (Cat no:10745-1-AP) |
| Azita (Verified Customer) (05-31-2021) | NSC-34 cells (motor neuron-like cells) strong labelling in WB Applications: Western Blot Primary Antibody Dilution: 1/2000 Cell Tissue Type: Human spinal cord (cervical) tissue |
| Zehua (Verified Customer) (12-17-2019) | After siRNA treatment for 48 hours, specific signal shown here. Works excellent! Applications: Western Blot, Cell culture, Primary Antibody Dilution: 1:1000 Cell Tissue Type: K562 NF-κB p65 Antibody Western Blot,Cell culture, validation (1:1000 dilution) in K562 (Cat no:10745-1-AP) |
| Feng-qian (Verified Customer) (12-07-2018) | Applications: Western Blot, Immunofluorescence, Primary Antibody Dilution: 1/500 Cell Tissue Type: HaCaT |
| Fraser (Verified Customer) (06-06-2018) | Applications: Other (please state below), |
| Citations | 2387 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RELA. Protocols Product Specific Protocols IF protocol for NF-κB p65 antibody 10745-1-AP Download protocol IHC protocol for NF-κB p65 antibody 10745-1-AP Download protocol IP protocol for NF-κB p65 antibody 10745-1-AP Download protocol WB protocol for NF-κB p65 antibody 10745-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma.
Journal: Signal Transduct Target Ther | Authors: Panpan Zhang | Species: human | Application: ChIP - Identification of glutamine as a potential therapeutic target in dry eye disease
Journal: Signal Transduct Target Ther | Authors: Xiaoniao Chen | Species: human | Application: WB - Overcoming tyrosine kinase inhibitor resistance in lung cancer brain metastasis with CTLA4 blockade
Journal: Cancer Cell | Authors: Minjie Fu | Species: human | Application: WB - Exosomes released by hepatocarcinoma cells endow adipocytes with tumor-promoting properties.
Journal: J Hematol Oncol | Authors: Shihua Wang | Species: human | Application: IF - Tumor stem-like cell-derived exosomal RNAs prime neutrophils for facilitating tumorigenesis of colon cancer.
Journal: J Hematol Oncol | Authors: Wei-Lun Hwang | Application: IF - Lung tumor exosomes induce a pro-inflammatory phenotype in mesenchymal stem cells via NFκB-TLR signaling pathway.
Journal: J Hematol Oncol | Authors: Xiaoxia Li | Species: human | Application: WB,IF - The interplay between tissue-resident microbiome and host proteins by integrated multi-omics during progression of colorectal adenoma to carcinoma.
Journal: Imeta | Authors: Di Wu | Species: mouse | Application: WB - Activation of the NF-¿B pathway as a mechanism of alcohol enhanced progression and metastasis of human hepatocellular carcinoma.
Journal: Mol Cancer | Authors: Fei Wang | Species: human | Application: WB - Oncogenic miR-210-3p promotes prostate cancer cell EMT and bone metastasis via NF-κB signaling pathway.
Journal: Mol Cancer | Authors: Dong Ren | Species: human | Application: WB - ESRP1-mediated biogenesis of circPTPN12 inhibits hepatocellular carcinoma progression by PDLIM2/ NF-κB pathway
Journal: Mol Cancer | Authors: Yang Ji | Species: mouse | Application: IHC - Microbial-derived 3-phenylpropionic acid orchestrates immune-progenitor cell crosstalk to promote beige adipogenesis and energy expenditure.
Journal: Cell Metab | Authors: Defu Li | Species: mouse | Application: WB,IF - Maltol induces diabetic fragility fractures by disrupting the balance of bone remodeling.
Journal: Cell Metab | Authors: Lizheng Yao | Species: mouse - Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury
Journal: Exploration (Beijing) | Authors: Jing Chang | Species: human | Application: WB - Suppression of Sepsis Cytokine Storm by Escherichia Coli Cell Wall-Derived Carbon Dots
Journal: Adv Mater | Authors: Yinan Li | Species: mouse | Application: WB - Sparcl1 mitigates abdominal aortic aneurysm through inhibiting lymphangiogenesis-mediated TLS formation
Journal: Nat Immunol | Authors: Mei-Hua Chen | Species: mouse,human | Application: WB - Intestinal taurine acts as a novel immunometabolic modulator of IBD by degrading redundant mitochondrial RNA
Journal: Cell Mol Immunol | Authors: Le-Xi Wu - Platelet NLRP6 protects against microvascular thrombosis in sepsis
Journal: Blood | Authors: Huimin Jiang | Species: mouse | Application: WB - FXYD3 enhances IL-17A signaling to promote psoriasis by competitively binding TRAF3 in keratinocytes
Journal: Cell Mol Immunol | Authors: Wenjuan Yang | Species: mouse | Application: WB - Platelet NLRP6 protects against microvascular thrombosis in sepsis
Journal: Blood | Authors: Huimin Jiang | Species: mouse | Application: WB - FXYD3 enhances IL-17A signaling to promote psoriasis by competitively binding TRAF3 in keratinocytes
Journal: Cell Mol Immunol | Authors: Wenjuan Yang | Species: mouse | Application: WB - Dental pulp stem cells alleviate Schwann cell pyroptosis via mitochondrial transfer to enhance facial nerve regeneration
Journal: Bioact Mater | Authors: Xiaoyu Zheng | Application: WB - Reprogramming exosomes for immunity-remodeled photodynamic therapy against non-small cell lung cancer
Journal: Bioact Mater | Authors: Jiao Guo | Species: mouse | Application: WB - M2 macrophage-derived exosomes delivering haptoglobin and interleukin-10 plasmids for synergistic therapy of intracerebral hemorrhage.
Journal: Bioact Mater | Authors: Ke Wang | Species: mouse | Application: IF - Silicate ions as soluble form of bioactive ceramics alleviate aortic aneurysm and dissection
Journal: Bioact Mater | Authors: Yumei Que | Species: mouse | Application: WB - Controlled TPCA-1 delivery engineers a pro-tenogenic niche to initiate tendon regeneration by targeting IKKβ/NF-κB signaling
Journal: Bioact Mater | Authors: Jialin Chen | Species: rat,human | Application: IHC,IF - KRAS-NFκB-YY1-miR-489 signaling axis controls pancreatic cancer metastasis.
Journal: Cancer Res | Authors: Peng Yuan | Species: human | Application: WB - YAP1 Inhibition Induces Phenotype Switching of Cancer-Associated Fibroblasts to Tumor Suppressive in Prostate Cancer
Journal: Cancer Res | Authors: Hongtao Song | Species: human | Application: WB,IF - Targeting Reticulin 4 (RTN4) Within Small Extracellular Vesicles Combats Metastasis and Reinforces Immunotherapy in Triple-Negative Breast Cancer
Journal: J Extracell Vesicles | Authors: Han Wang - The 8-oxoguanine DNA glycosylase-synaptotagmin 7 pathway increases extracellular vesicle release and promotes tumour metastasis during oxidative stress
Journal: J Extracell Vesicles | Authors: Ying Ma | Species: human | Application: WB,IF - Excitatory amino acid transporter supports inflammatory macrophage responses
Journal: Sci Bull (Beijing) | Authors: Zhending Gan | Species: mouse | Application: ChIP - Osteopontin deficiency promotes cartilaginous endplate degeneration by enhancing the NF-κB signaling to recruit macrophages and activate the NLRP3 inflammasome
Journal: Bone Res | Authors: Yanqiu Wang | Species: mouse,human | Application: WB - Chaperone-mediated autophagy directs a dual mechanism to balance premature senescence and senolysis to prevent intervertebral disc degeneration
Journal: Bone Res | Authors: Zhangrong Cheng | Species: human | Application: WB,IF - IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection.
Journal: Nat Microbiol | Authors: Zhimin Jiang | Species: human | Application: WB - Increased mitochondrial fission promotes autophagy and hepatocellular carcinoma cell survival through the ROS-modulated coordinated regulation of the NFKB and TP53 pathways.
Journal: Autophagy | Authors: Qichao Huang | Species: human | Application: WB - m6A mRNA methylation regulates testosterone synthesis through modulating autophagy in Leydig cells.
Journal: Autophagy | Authors: Yabing Chen | Species: mouse | Application: WB - RNF144A inhibits autophagy by targeting BECN1 for degradation during L. monocytogenes infection
Journal: Autophagy | Authors: Bo Yang | Species: human - RNF144A inhibits autophagy by targeting BECN1 for degradation during L. monocytogenes infection
Journal: Autophagy | Authors: Bo Yang | Species: human - A DNA-based nanodevice senses purinergic signaling and drives an immune switch for resolving inflammation.
Journal: Nat Commun | Authors: Wei Li | Species: mouse | Application: WB - Reducing Akt2 in retinal pigment epithelial cells causes a compensatory increase in Akt1 and attenuates diabetic retinopathy
Journal: Nat Commun | Authors: Haitao Liu | Species: mouse | Application: WB - Denosumab attenuates knee osteoarthritis progression by inhibiting synovial inflammation via the RANK/TRAF6/FSTL1 signalling.
Journal: Nat Commun | Authors: Yuxiang Hu | Species: human | Application: WB,IF - Dual rectification of metabolism abnormality in pancreatic cancer by a programmed nanomedicine
Journal: Nat Commun | Authors: Bowen Wu | Species: mouse,human | Application: WB,IHC,IF - Renal insulin-like growth factor binding-protein 7 is a critical promoter of progressive diabetic kidney disease.
Journal: Nat Commun | Authors: Ju-tao Yu | Species: mouse,human | Application: WB,IP,IHC,IF - Inflammation-specific DNA origami nanodevice for delivery of siRNAs to treat ulcerative colitis.
Journal: Nat Commun | Authors: Tianci Zhang | Species: mouse | Application: WB - REV-ERBα integrates colon clock with experimental colitis through regulation of NF-κB/NLRP3 axis.
Journal: Nat Commun | Authors: Shuai Wang | Species: mouse | Application: WB - Periodontitis pathogen Porphyromonas gingivalis promotes chronic obstructive pulmonary disease via affecting neutrophils chemotaxis and function.
Journal: Int J Oral Sci | Authors: Luyao Zhang | Species: mouse | Application: WB - Hypothermic oxygenated perfusion inhibits CLIP1-mediated TIRAP ubiquitination via TFPI2 to reduce ischemia‒reperfusion injury of the fatty liver
Journal: Exp Mol Med | Authors: Pengpeng Yue | Species: rat,human | Application: WB - Readily Available Oral Prebiotic Protein Reactive Oxygen Species Nanoscavengers for Synergistic Therapy of Inflammation and Fibrosis in Inflammatory Bowel Disease
Journal: ACS Nano | Authors: Yang Yu | Species: human | Application: WB - TA-Zr/Ce Nanozyme-Mediated Lipopolysaccharide Dephosphorylation: A Targeted Strategy for Sepsis Treatment with Hemoperfusion Applications.
Journal: ACS Nano | Authors: Xuan Zhao | Species: mouse,human | Application: WB,IF - Readily Available Oral Prebiotic Protein Reactive Oxygen Species Nanoscavengers for Synergistic Therapy of Inflammation and Fibrosis in Inflammatory Bowel Disease
Journal: ACS Nano | Authors: Yang Yu | Species: human | Application: WB - A Therapeutic System Regulating Iron Metabolism in CD63+ Macrophage Subsets Activates Anti-tumor Immunity for Bone Metastasis Therapy
Journal: ACS Nano | Authors: Yucheng Xue - Ginsenoside Rh1 ameliorates polystyrene nanoplastics-caused vascular injury by regulating HSP70 to suppress endoplasmic reticulum stress and pyroptosis.
Journal: J Adv Res | Authors: Yue-qin Song | Species: mouse,human | Application: WB,IF,CoIP - Ginsenoside Rh4 inhibits colorectal cancer via the modulation of gut microbiota-mediated bile acid metabolism
Journal: J Adv Res | Authors: Xue Bai | Species: mouse | Application: WB - PERK drives aflatoxin B1-induced chicken cellular senescence by promoting NLRP3-mediated PANoptosis.
Journal: J Adv Res | Authors: Yue Cheng | Species: chicken | Application: WB - TRPM2-mediated feed-forward loop promotes chondrocyte damage in osteoarthritis via calcium-cGAS-STING-NF-κB pathway
Journal: J Adv Res | Authors: Kai Sun | Species: mouse | Application: WB - Far-infrared radiation prevents decline in β-cell mass and function in diabetic mice via the mitochondria-mediated Sirtuin1 pathway.
Journal: Metabolism | Authors: Yung-Ho Hsu | Species: rat | Application: WB - Increased adrenal steroidogenesis and suppressed corticosteroid responsiveness in critical COVID-19
Journal: Metabolism | Authors: Tian-Zi Wen | Species: human | Application: IF - Lipoxin A4 ameliorates knee osteoarthritis progression in rats by antagonizing ferroptosis through activation of the ESR2/LPAR3/Nrf2 axis in synovial fibroblast-like synoviocytes
Journal: Redox Biol | Authors: Zhehan Hu | Species: rat | Application: WB,IF - Cardioprotection of CAPE-oNO2 against myocardial ischemia/reperfusion induced ROS generation via regulating the SIRT1/eNOS/NF-κB pathway in vivo and in vitro.
Journal: Redox Biol | Authors: Dejuan Li | Species: rat | Application: WB - Keratin utilizes H(2)S to promote HMGB1 sulfhydration for inflammation resolution.
Journal: Redox Biol | Authors: Xiaozheng Huang - Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation
Journal: Mol Cell | Authors: Chuanlong Wang | Species: mouse | Application: WB - Overexpression of steroidogenic acute regulatory protein in rat aortic endothelial cells attenuates palmitic acid-induced inflammation and reduction in nitric oxide bioavailability.
Journal: Cardiovasc Diabetol | Authors: Tian Dai D | Species: rat | Application: WB - Probiotic Lactobacillus casei improves immune microenvironment in rheumatoid arthritis via gut microbiota-butyrate-HDAC/NF-κB signaling.
Journal: Gut Microbes | Authors: Yanmiao Ma | Species: mouse | Application: WB,IF - A virulence factor as a therapeutic: the probiotic Enterococcus faecium SF68 arginine deiminase inhibits innate immune signaling pathways
Journal: Gut Microbes | Authors: Fereshteh Ghazisaeedi | Species: pig | Application: WB,IF - Gut microbiota regulates host melatonin production through epithelial cell MyD88
Journal: Gut Microbes | Authors: Bingnan Liu | Species: mouse | Application: WB - Circadian disruption and ROS-NLRP3 signaling mediate sleep deprivation-enhanced silica nanoparticle toxicity in lacrimal glands
Journal: J Nanobiotechnology | Authors: Wenxiao Zhang | Species: mouse | Application: WB - A TEMPO-loaded DNA hydrogel enabling integrated early diagnosis and treatment of osteoarthritis.
Journal: J Nanobiotechnology | Authors: Hong Huang | Species: human | Application: WB - Macrophage biomimetic nanoparticle-targeted functional extracellular vesicle micro-RNAs revealed via multiomics analysis alleviate sepsis-induced acute lung injury
Journal: J Nanobiotechnology | Authors: Guozhen Wang | Species: mouse | Application: WB - Macrophage-mimetic liposomes co-delivering ceria and Ac2-26 peptide for penumbra protection in ischemic stroke
Journal: J Nanobiotechnology | Authors: Lingyun Bai | Species: mouse | Application: WB - The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.
Journal: Nucleic Acids Res | Authors: Xin Zong | Species: pig | Application: WB - Probiotics alleviate chronic ethanol exposure-induced anxiety-like behavior and hippocampal neuroinflammation in male mice through gut microbiota-derived extracellular vesicles
Journal: J Nanobiotechnology | Authors: Jiaxin Pei | Species: mouse | Application: WB - Synergy of nanodiamond-doxorubicin conjugates and PD-L1 blockade effectively turns tumor-associated macrophages against tumor cells
Journal: J Nanobiotechnology | Authors: Hua‑Zhen Xu | Species: mouse,human | Application: WB,IHC,IF - Degenerated nucleus pulposus cells derived exosome carrying miR-27a-3p aggravates intervertebral disc degeneration by inducing M1 polarization of macrophages
Journal: J Nanobiotechnology | Authors: Xin Zhao | Species: human | Application: WB - Probiotics alleviate chronic ethanol exposure-induced anxiety-like behavior and hippocampal neuroinflammation in male mice through gut microbiota-derived extracellular vesicles
Journal: J Nanobiotechnology | Authors: Jiaxin Pei | Species: mouse | Application: WB - Degenerated nucleus pulposus cells derived exosome carrying miR-27a-3p aggravates intervertebral disc degeneration by inducing M1 polarization of macrophages
Journal: J Nanobiotechnology | Authors: Xin Zhao | Species: human | Application: WB - Circadian disruption and ROS-NLRP3 signaling mediate sleep deprivation-enhanced silica nanoparticle toxicity in lacrimal glands
Journal: J Nanobiotechnology | Authors: Wenxiao Zhang | Species: mouse | Application: WB - Mesoporous catechin hydrogel for enhanced astaxanthin-based inflammatory bowel disease therapy.
Journal: J Nanobiotechnology | Authors: Ningli Guo | Species: mouse | Application: WB - Palladium nanozyme loaded metal-organic framework eyedrops alleviate oxidative stress for dry eye treatment.
Journal: J Nanobiotechnology | Authors: Yajia Wang | Species: mouse | Application: IF - Platelet-rich plasma-derived exosomes promote blood-spinal cord barrier repair and attenuate neuroinflammation after spinal cord injury
Journal: J Nanobiotechnology | Authors: Xinyu Nie | Species: mouse | Application: WB,IF - Palladium nanozyme loaded metal-organic framework eyedrops alleviate oxidative stress for dry eye treatment.
Journal: J Nanobiotechnology | Authors: Yajia Wang | Species: mouse | Application: IF - Nanoparticle-integrated smart hydrogel with H(2)S-triggered antibacterial escalation and sustained oxygen release for periodontal regeneration.
Journal: J Nanobiotechnology | Authors: Jingshu Yang - Genetic and pharmacological activation of Hedgehog signaling inhibits osteoclastogenesis and attenuates titanium particle-induced osteolysis partly through suppressing the JNK/c-Fos-NFATc1 cascade.
Journal: Theranostics | Authors: Liwei Zhang | Species: mouse | Application: WB - Mn3O4 nanozyme-based anti-inflammatory therapy modulates microglial phenotype by downregulating TLR4/NOX2 expression and further alleviates Alzheimer's disease pathology
Journal: Theranostics | Authors: Jun Xie | Species: mouse | Application: WB - Macrophage-biomimetic nanomedicine for targeted therapy of abdominal aortic aneurysm via Nrf2/NF-κB pathway.
Journal: Theranostics | Authors: Qiujie Luo | Species: mouse | Application: WB - Hepatic RACK1 deficiency protects against fulminant hepatitis through myeloid-derived suppressor cells.
Journal: Theranostics | Authors: Genyu Liu | Application: WB - NUDT21 inhibits bladder cancer progression through ANXA2 and LIMK2 by alternative polyadenylation.
Journal: Theranostics | Authors: Ming Xiong | Species: human | Application: IHC - Macrophage-biomimetic nanomedicine for targeted therapy of abdominal aortic aneurysm via Nrf2/NF-κB pathway.
Journal: Theranostics | Authors: Qiujie Luo | Species: mouse | Application: WB - Hepatic RACK1 deficiency protects against fulminant hepatitis through myeloid-derived suppressor cells.
Journal: Theranostics | Authors: Genyu Liu | Application: WB - The delta subunit of the GABAA receptor is necessary for the GPT2-promoted breast cancer metastasis
Journal: Theranostics | Authors: Na Li | Species: human | Application: WB - Ferrum@albumin assembled nanoclusters inhibit NF-κB signaling pathway for NIR enhanced acute lung injury immunotherapy.
Journal: Acta Pharm Sin B | Authors: Xiaoxuan Guan | Species: mouse | Application: WB - Single-cell transcriptomics reveals the ameliorative effect of rosmarinic acid on diabetic nephropathy-induced kidney injury by modulating oxidative stress and inflammation
Journal: Acta Pharm Sin B | Authors: Junhui Chen | Species: mouse | Application: WB - Tumor-secreted IFI35 promotes proliferation and cytotoxic activity of CD8+ T cells through PI3K/AKT/mTOR signaling pathway in colorectal cancer
Journal: J Biomed Sci | Authors: Peisi Li | Species: mouse | Application: WB - Neutrophil-macrophage crosstalk via NETs-IL-17/VEGF/S100A9 axis promotes hepatocellular carcinoma progression.
Journal: J Exp Clin Cancer Res | Authors: Rong Wu | Species: mouse,human | Application: WB - HOXA10 drives immune evasion in early lung adenocarcinoma by recruiting immunosuppressive macrophages via NF-κB/CCL2 signaling.
Journal: J Exp Clin Cancer Res | Authors: Jiakang Ma | Species: mouse | Application: IF - Superior anti-DLBCL efficacy of novel organic arsenical Z2-A-Z2 through ROS-mediated apoptosis and critical NF-κB/IκBα signaling pathway inhibition.
Journal: J Exp Clin Cancer Res | Authors: Wenjiao Wei - MEST promotes lung cancer invasion and metastasis by interacting with VCP to activate NF-κB signaling.
Journal: J Exp Clin Cancer Res | Authors: Yang Wang | Species: human | Application: WB - Downregulation of miR-141-3p promotes bone metastasis via activating NF-κB signaling in prostate cancer.
Journal: J Exp Clin Cancer Res | Authors: Shuai Huang | Species: human | Application: WB - HOXA10 drives immune evasion in early lung adenocarcinoma by recruiting immunosuppressive macrophages via NF-κB/CCL2 signaling.
Journal: J Exp Clin Cancer Res | Authors: Jiakang Ma | Species: mouse | Application: IF - Star-related lipid transfer protein 10 (STARD10): a novel key player in alcohol-induced breast cancer progression.
Journal: J Exp Clin Cancer Res | Authors: Andrea Floris | Species: human | Application: WB,chIP - Reprogramming Lung Redox Homeostasis by NIR Driven Ultra-Small Pd Loaded Covalent Organic Framework Inhibits NF-κB Pathway for Acute Lung Injury Immunotherapy
Journal: Adv Sci (Weinh) | Authors: Doudou Lei | Species: mouse | Application: WB - CXCL13 Expression Promotes CAR T Cell Antitumor Activity and Potentiates Response to PD-1 Blockade
Journal: Adv Sci (Weinh) | Authors: Yang Zhou | Application: WB - OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression
Journal: Adv Sci (Weinh) | Authors: Xingran Li | Species: human | Application: WB - Role of SLC16A10 in Psoriasis Through the Regulation of Arachidonic Acid Metabolism in Keratinocytes
Journal: Adv Sci (Weinh) | Authors: Jingyuan Yang | Application: WB - H3K36me3-Guided m6A Modification of Oncogenic L1CAM-AS1 Drives Macrophage Polarization and Immunotherapy Resistance in Hepatocellular Carcinoma
Journal: Adv Sci (Weinh) | Authors: Teng Wang - OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression
Journal: Adv Sci (Weinh) | Authors: Xingran Li | Species: human | Application: WB - Sirtuin 5-Mediated Desuccinylation of ALDH2 Alleviates Mitochondrial Oxidative Stress Following Acetaminophen-Induced Acute Liver Injury
Journal: Adv Sci (Weinh) | Authors: Qiwen Yu | Species: mouse | Application: WB - An Anti-CD147 Antibody-Drug Conjugate Mehozumab-DM1 is Efficacious Against Hepatocellular Carcinoma in Cynomolgus Monkey
Journal: Adv Sci (Weinh) | Authors: Wan Huang | Species: human | Application: WB - TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration.
Journal: Adv Sci (Weinh) | Authors: Yan Pu | Species: mouse,human | Application: WB - Reprogramming Lung Redox Homeostasis by NIR Driven Ultra-Small Pd Loaded Covalent Organic Framework Inhibits NF-κB Pathway for Acute Lung Injury Immunotherapy
Journal: Adv Sci (Weinh) | Authors: Doudou Lei | Species: mouse | Application: WB - H3K36me3-Guided m6A Modification of Oncogenic L1CAM-AS1 Drives Macrophage Polarization and Immunotherapy Resistance in Hepatocellular Carcinoma
Journal: Adv Sci (Weinh) | Authors: Teng Wang - An Anti-CD147 Antibody-Drug Conjugate Mehozumab-DM1 is Efficacious Against Hepatocellular Carcinoma in Cynomolgus Monkey
Journal: Adv Sci (Weinh) | Authors: Wan Huang | Species: human | Application: WB - Disruption of NF-κB-Mediated Copper Homeostasis Sensitizes Breast Cancer to Cuproptosis
Journal: Adv Sci (Weinh) | Authors: Xiaomei Zhang - iPSC-derived NK cells with site-specific integration of CAR19 and IL24 at the multi-copy rDNA locus enhanced antitumor activity and proliferation
Journal: MedComm (2020) | Authors: Yuxuan Zhang | Species: human | Application: WB - Reprogramming Lung Redox Homeostasis by NIR Driven Ultra-Small Pd Loaded Covalent Organic Framework Inhibits NF-κB Pathway for Acute Lung Injury Immunotherapy
Journal: Adv Sci (Weinh) | Authors: Doudou Lei | Species: mouse | Application: WB - TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration.
Journal: Adv Sci (Weinh) | Authors: Yan Pu | Species: mouse,human | Application: WB - JLP-centrosome is essential for the microtubule-mediated nucleocytoplasmic transport induced by extracellular stimuli.
Journal: Sci Adv | Authors: Clement M Lee | Species: human | Application: WB - d-amino acids restrain macrophage IL-1β release through gasdermin D acetylation.
Journal: Sci Adv | Authors: Zebiao Wu | Species: mouse | Application: ChIP - SRC-mediated phosphorylation of UBC9 regulates inflammatory and metabolic signaling in alcohol-associated liver disease.
Journal: Sci Adv | Authors: Swati Chandla | Species: mouse | Application: IF - In situ-formed immunotherapeutic hydrogel containing sphingosine-1-phosphate for enhanced lung cancer immunotherapy.
Journal: Sci Adv | Authors: Hui Shen | Species: mouse | Application: WB - Asparagine transporter supports macrophage inflammation via histone phosphorylation
Journal: Sci Adv | Authors: Chuanlong Wang | Species: mouse | Application: WB - Nutrient availability regulates the secretion and function of immune cell-derived extracellular vesicles through metabolic rewiring
Journal: Sci Adv | Authors: Yizhuo Wang | Species: mouse | Application: WB - Atypical inflammatory kinase IKBKE phosphorylates and inactivates FoxA1 to promote liver tumorigenesis
Journal: Sci Adv | Authors: Bing Gao | Species: human | Application: WB - Targeted regulation of lymphocytic ER stress response with an overall immunosuppression to alleviate allograft rejection.
Journal: Biomaterials | Authors: Yingying Shi | Species: mouse | Application: WB,IF - Endoplasmic reticulum-targeted inhibition of CYP2E1 with vitamin E nanoemulsions alleviates hepatocyte oxidative stress and reverses alcoholic liver disease
Journal: Biomaterials | Authors: Yingying Shi | Species: mouse | Application: IF - Black phosphorus nanosheets activate tumor immunity of glioblastoma by modulating the expression of the immunosuppressive molecule PD-L1
Journal: Biomaterials | Authors: Yue Xiong | Species: mouse | Application: WB - Targeting NF-kB signaling with polymeric hybrid micelles that co-deliver siRNA and dexamethasone for arthritis therapy.
Journal: Biomaterials | Authors: Qin Wang | Species: mouse | Application: WB,IF - Structurally dynamic self-healable hydrogel cooperatively inhibits intestinal inflammation and promotes mucosal repair for enhanced ulcerative colitis treatment
Journal: Biomaterials | Authors: Xinyue Ge | Species: mouse | Application: WB - Dual-loaded BMSCs-Metformin microgels promote cartilage repair through combined anti-inflammatory, antioxidant, and regenerative effects.
Journal: Biomaterials | Authors: Danmei Li | Species: rat | Application: WB,IF - Black phosphorus nanosheets activate tumor immunity of glioblastoma by modulating the expression of the immunosuppressive molecule PD-L1
Journal: Biomaterials | Authors: Yue Xiong | Species: mouse | Application: WB - Fatty acid synthesis promotes mtDNA release via ETS1-mediated oligomerization of VDAC1 facilitating endothelial dysfunction in sepsis-induced lung injury
Journal: Cell Death Differ | Authors: Shiyuan He | Species: human | Application: WB,IF - Virus-inspired Ganoderma lucidum polysaccharide-functionalized adjuvant with pseudo-zwitterionic interface for potentiated nasal immunization.
Journal: Carbohydr Polym | Authors: Xu-Han Liu | Species: mouse | Application: WB - Structure characterization and in vitro immunomodulatory effects of a novel galactoglucomannan in cultivated Chinese cordyceps (Cordyceps sinensis).
Journal: Carbohydr Polym | Authors: Zhengming Qian | Species: mouse | Application: WB - Carboxymethyl chitosan and sodium alginate oxide pH-sensitive dual-release hydrogel for diabetes wound healing: The combination of astilbin liposomes and diclofenac sodium
Journal: Carbohydr Polym | Authors: Xiaoyu Wu | Species: mouse | Application: WB,IF - FOSL2-driven SASP in endometrial stroma promotes the inflammation of endometriosis.
Journal: NPJ Aging | Authors: Weiwei Shi | Species: human | Application: WB - Herpetrione, a New Type of PPARα Ligand as a Therapeutic Strategy Against Nonalcoholic Steatohepatitis
Journal: Research (Wash D C) | Authors: Lang Linghu | Species: mouse,human | Application: WB,IF - SENP6 Restrains NLRP3 Inflammasome Activation via DeSUMOylation-Driven K48-Linked Ubiquitination of NLRP3 in Acute Lung Injury.
Journal: Research (Wash D C) | Authors: Angran Gu | Species: mouse,human | Application: WB - PRMT1-Mediated PARP1 Methylation Drives Lung Metastasis and Chemoresistance via P65 Activation in Triple-Negative Breast Cancer.
Journal: Research (Wash D C) | Authors: Jinhui Zhang | Species: human | Application: WB - Time serial transcriptome reveals Cyp2c29 as a key gene in hepatocellular carcinoma development.
Journal: Cancer Biol Med | Authors: Qi Wang | Species: human | Application: WB - JaponiconeA induces apoptosis of bortezomib-sensitive and -resistant myeloma cells in vitro and in vivo by targeting IKK.
Journal: Cancer Biol Med | Authors: Zilu Zhang | Species: human | Application: WB,IF - Flash nano-encapsulation of probiotics: Bolstering environmental resistance and intestinal colonization to prevent necrotizing enterocolitis.
Journal: J Control Release | Authors: Yanbing Huang | Species: mouse | Application: WB - Time serial transcriptome reveals Cyp2c29 as a key gene in hepatocellular carcinoma development.
Journal: Cancer Biol Med | Authors: Qi Wang | Species: human | Application: WB - Enzyme-instructed self-assembly of peptide-drug conjugates in tear fluids for ocular drug delivery.
Journal: J Control Release | Authors: Yuhan Hu | Application: IF - A responsive hydrogel modulates innate immune cascade fibrosis to promote ocular surface reconstruction after chemical injury
Journal: J Control Release | Authors: Jun Zhang | Species: mouse | Application: WB - Disocin prevents postmenopausal atherosclerosis in ovariectomized LDLR-/- mice through a PGC-1α/ERα pathway leading to promotion of autophagy and inhibition of oxidative stress, inflammation and apoptosis.
Journal: Pharmacol Res | Authors: Qining Yang | Species: mouse | Application: WB - ADAP-METTL3 modulates the inflammatory responses of macrophages via m(6)A modification of Spry1.
Journal: Cell Death Dis | Authors: Anqi Dong | Species: mouse | Application: WB - miR-223-3p improves macrophage polarization balance and mitochondrial metabolism to ameliorate uveitis by orchestrating P65(Lys310) acetylation through RBPJ/HDAC1 axis.
Journal: Cell Mol Biol Lett | Authors: Yuan Peng | Species: rat,human | Application: IHC,IF - ILF3 promotes colorectal cancer cell resistance to ferroptosis by enhancing cysteine uptake and GSH synthesis via stabilizing SLC3A2 mRNA.
Journal: Cell Death Dis | Authors: Shuhao Wang | Species: human | Application: WB,IP,IHC,IF,CoIP,ChIP - MSCs-extracellular vesicles attenuated neuroinflammation, synapse damage and microglial phagocytosis after hypoxia-ischemia injury by preventing osteopontin expression.
Journal: Pharmacol Res | Authors: Danqing Xin | Species: mouse | Application: WB - Apoptotic caspase inhibits innate immune signaling by cleaving NF-κBs in both Mammals and Flies
Journal: Cell Death Dis | Authors: Di Wu | Species: human | Application: WB - The histone deacetylase inhibitor belinostat ameliorates experimental autoimmune encephalomyelitis in mice by inhibiting TLR2/MyD88 and HDAC3/ NF-κB p65-mediated neuroinflammation
Journal: Pharmacol Res | Authors: Yanjia Shen | Species: mouse | Application: WB - Maternal Exposure to Di-n-butyl Phthalate Promotes the Formation of Testicular Tight Junctions through Downregulation of NF-κB/COX-2/PGE2/MMP-2 in Mouse Offspring.
Journal: Environ Sci Technol | Authors: Tan Ma | Species: mouse | Application: IF,ChIP - 6-Gingerol protects intestinal barrier from ischemia/reperfusion-induced damage via inhibition of p38 MAPK to NF-κB signalling.
Journal: Pharmacol Res | Authors: Yanli Li | Species: rat | Application: WB,IF - UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence.
Journal: Cell Death Dis | Authors: Yunhao Chang | Species: mouse | Application: WB - ILF3 promotes colorectal cancer cell resistance to ferroptosis by enhancing cysteine uptake and GSH synthesis via stabilizing SLC3A2 mRNA.
Journal: Cell Death Dis | Authors: Shuhao Wang | Species: human | Application: WB,IP,IHC,IF,CoIP,ChIP - Maternal Exposure to Di-n-butyl Phthalate Promotes the Formation of Testicular Tight Junctions through Downregulation of NF-κB/COX-2/PGE2/MMP-2 in Mouse Offspring.
Journal: Environ Sci Technol | Authors: Tan Ma | Species: mouse | Application: IF,ChIP - PRMT5 critically mediates TMAO-induced inflammatory response in vascular smooth muscle cells.
Journal: Cell Death Dis | Authors: He Liu | Application: WB - A novel c-Met/TRK inhibitor 1D228 efficiently inhibits tumor growth by targeting angiogenesis and tumor cell proliferation
Journal: Cell Death Dis | Authors: Baijiao An | Species: human | Application: WB - Maternal Exposure to Di-n-butyl Phthalate Promotes the Formation of Testicular Tight Junctions through Downregulation of NF-κB/COX-2/PGE2/MMP-2 in Mouse Offspring.
Journal: Environ Sci Technol | Authors: Tan Ma | Species: mouse | Application: IF,ChIP - A novel c-Met/TRK inhibitor 1D228 efficiently inhibits tumor growth by targeting angiogenesis and tumor cell proliferation
Journal: Cell Death Dis | Authors: Baijiao An | Species: human | Application: WB - GNAS promotes inflammation-related hepatocellular carcinoma progression by promoting STAT3 activation.
Journal: Cell Mol Biol Lett | Authors: Hongda Ding | Species: human | Application: WB - The histone deacetylase inhibitor belinostat ameliorates experimental autoimmune encephalomyelitis in mice by inhibiting TLR2/MyD88 and HDAC3/ NF-κB p65-mediated neuroinflammation
Journal: Pharmacol Res | Authors: Yanjia Shen | Species: mouse | Application: WB - Pharmacological preconditioning with the cellular stress inducer thapsigargin protects against experimental sepsis.
Journal: Pharmacol Res | Authors: Yaping Wei | Species: mouse | Application: WB - 6-Gingerol protects intestinal barrier from ischemia/reperfusion-induced damage via inhibition of p38 MAPK to NF-κB signalling.
Journal: Pharmacol Res | Authors: Yanli Li | Species: rat | Application: WB,IF - AARS1 promotes diabetic kidney disease through rewiring Akt and NF-κB signaling to suppress autophagy and sustain inflammation.
Journal: Cell Mol Biol Lett | Authors: Lei Tian | Species: mouse,human | Application: WB,IP,ChIP - MMP14high macrophages orchestrate progressive pulmonary fibrosis in SR-Ag-induced hypersensitivity pneumonitis
Journal: Pharmacol Res | Authors: Dan Peng | Species: mouse | Application: WB,IF - TRIM31 triggers colorectal carcinogenesis and progression by maintaining YBX1 protein stability through ubiquitination modification
Journal: Cell Death Dis | Authors: Xiaoqing Li - Pharmacological preconditioning with the cellular stress inducer thapsigargin protects against experimental sepsis.
Journal: Pharmacol Res | Authors: Yaping Wei | Species: mouse | Application: WB - MTFR2 promotes VDAC1 oligomerization to reprogram BCAA metabolism in tumor cells to polarize TAMs in LUAD.
Journal: Cell Death Dis | Authors: Yutong Ge | Species: human | Application: WB,IF,ChIP - ILF3 promotes colorectal cancer cell resistance to ferroptosis by enhancing cysteine uptake and GSH synthesis via stabilizing SLC3A2 mRNA.
Journal: Cell Death Dis | Authors: Shuhao Wang | Species: human | Application: WB,IP,IHC,IF,CoIP,ChIP - Dioscin ameliorates intestinal ischemia/reperfusion injury via adjusting miR-351-5p/MAPK13-mediated inflammation and apoptosis.
Journal: Pharmacol Res | Authors: Lingli Zheng | Species: rat | Application: WB - Cytoplasmic fragment of CD147 generated by regulated intramembrane proteolysis contributes to HCC by promoting autophagy.
Journal: Cell Death Dis | Authors: Bo Wu | Species: human | Application: WB - PRMT5 critically mediates TMAO-induced inflammatory response in vascular smooth muscle cells.
Journal: Cell Death Dis | Authors: He Liu | Application: WB - A novel c-Met/TRK inhibitor 1D228 efficiently inhibits tumor growth by targeting angiogenesis and tumor cell proliferation
Journal: Cell Death Dis | Authors: Baijiao An | Species: human | Application: WB - MTFR2 promotes VDAC1 oligomerization to reprogram BCAA metabolism in tumor cells to polarize TAMs in LUAD.
Journal: Cell Death Dis | Authors: Yutong Ge | Species: human | Application: WB,IF,ChIP - In situ spatiotemporal tracking of endogenous protein dynamics with allosteric genetically encoded biosensor in living cells.
Journal: Biosens Bioelectron | Authors: Mingfeng Xie | Species: human | Application: WB - A novel promoter-associated non-coding small RNA paGLI1 recruits FUS/P65 to transactivate GLI1 gene expression and promotes infiltrating glioma progression.
Journal: Cancer Lett | Authors: Jinjing Zhong | Species: human | Application: WB,CoIP - Translating m6A-Glycolysis Discovery into Therapy: GOQD-Based Multifunctional Bioactive Scaffolds Rejuvenates Bone Repair in Senescence.
Journal: Small | Authors: Zengguang Wang | Species: rat | Application: WB - Cleavage and polyadenylation specific factor 4 targets NF-κB/cyclooxygenase-2 signaling to promote lung cancer growth and progression.
Journal: Cancer Lett | Authors: Canhui Yi - Auranofin facilitates gemcitabine sensitivity by regulating TXNRD1-related ferroptosis in pancreatic ductal adenocarcinoma.
Journal: Cancer Lett | Authors: Si-Yuan Lu | Species: human | Application: WB - Injectable Multifunctional Composite Hydrogel as a Combination Therapy for Preventing Postsurgical Adhesion
Journal: Small | Authors: Ke Lv | Species: rat | Application: WB - In situ spatiotemporal tracking of endogenous protein dynamics with allosteric genetically encoded biosensor in living cells.
Journal: Biosens Bioelectron | Authors: Mingfeng Xie | Species: human | Application: WB - ROS Responsive Cerium Oxide Biomimetic Nanoparticles Alleviates Calcium Oxalate Crystals Induced Kidney Injury via Suppressing Oxidative Stress and M1 Macrophage Polarization
Journal: Small | Authors: Yu He | Species: mouse | Application: WB,IHC,IF,ELISA - A novel promoter-associated non-coding small RNA paGLI1 recruits FUS/P65 to transactivate GLI1 gene expression and promotes infiltrating glioma progression.
Journal: Cancer Lett | Authors: Jinjing Zhong | Species: human | Application: WB,CoIP - Downregulation of m6A Reader YTHDC2 Promotes the Proliferation and Migration of Malignant Lung Cells via CYLD/NF-κB Pathway.
Journal: Int J Biol Sci | Authors: Jin Wang | Species: human | Application: WB,IHC - Ozone Therapy Attenuates NF-κB-Mediated Local Inflammatory Response and Activation of Th17 Cells in Treatment for Psoriasis.
Journal: Int J Biol Sci | Authors: Jinrong Zeng | Species: mouse,human | Application: IHC - HIV-1-infected cell-derived exosomes promote the growth and progression of cervical cancer.
Journal: Int J Biol Sci | Authors: Haiyu Li | Application: WB - Helicobacter pylori infection disturbs the tumor immune microenvironment and is associated with a discrepant prognosis in gastric de novo diffuse large B-cell lymphoma.
Journal: J Immunother Cancer | Authors: Yuwei Deng | Species: human | Application: IHC - Downregulation of m6A Reader YTHDC2 Promotes the Proliferation and Migration of Malignant Lung Cells via CYLD/NF-κB Pathway.
Journal: Int J Biol Sci | Authors: Jin Wang | Species: human | Application: WB,IHC - HIV-1-infected cell-derived exosomes promote the growth and progression of cervical cancer.
Journal: Int J Biol Sci | Authors: Haiyu Li | Application: WB - Ozone Therapy Attenuates NF-κB-Mediated Local Inflammatory Response and Activation of Th17 Cells in Treatment for Psoriasis.
Journal: Int J Biol Sci | Authors: Jinrong Zeng | Species: mouse,human | Application: IHC - Metformin Sensitizes Non-small Cell Lung Cancer Cells to an Epigallocatechin-3-Gallate (EGCG) Treatment by Suppressing the Nrf2/HO-1 Signaling Pathway.
Journal: Int J Biol Sci | Authors: Chenxiao Yu | Species: human | Application: WB - CD24 recruits tumor-associated neutrophils to promote the progression of hepatocellular carcinoma
Journal: J Immunother Cancer | Authors: Jun Wang | Application: WB - BMAL1 regulates Propionibacterium acnes-induced skin inflammation via REV-ERBα in mice.
Journal: Int J Biol Sci | Authors: Feng Li | Species: mouse | Application: WB - CD24 recruits tumor-associated neutrophils to promote the progression of hepatocellular carcinoma
Journal: J Immunother Cancer | Authors: Jun Wang | Application: WB - Free heme induces neuroinflammation and cognitive impairment by microglial activation via the TLR4/MyD88/NF-κB signaling pathway
Journal: Cell Commun Signal | Authors: Xin Wei | Species: rat,mouse | Application: WB - HPV11 targeting KDM4A regulates the polarization of macrophage M1 and promotes the development of nasal inverted papilloma
Journal: Cell Commun Signal | Authors: Liying Zheng | Species: human | Application: WB - Aiduqing formula inhibits breast cancer metastasis by suppressing TAM/CXCL1-induced Treg differentiation and infiltration.
Journal: Cell Commun Signal | Authors: Jing Li | Species: human | Application: WB - Wnt5a-induced M2 polarization of tumor-associated macrophages via IL-10 promotes colorectal cancer progression.
Journal: Cell Commun Signal | Authors: Qing Liu | Species: human | Application: WB - Activity-based chemical proteomics reveals caffeic acid ameliorates pentylenetetrazol-induced seizures by covalently targeting aconitate decarboxylase 1
Journal: Cell Commun Signal | Authors: Guanjun Li | Species: mouse | Application: WB - Downregulation of CD151 restricts VCAM-1 mediated leukocyte infiltration to reduce neurobiological injuries after experimental stroke.
Journal: J Neuroinflammation | Authors: Ceshu Gao | Species: mouse | Application: WB - NOD2 promotes dopaminergic degeneration regulated by NADPH oxidase 2 in 6-hydroxydopamine model of Parkinson's disease.
Journal: J Neuroinflammation | Authors: Li Cheng | Species: mouse | Application: WB - A short peptide exerts neuroprotective effects on cerebral ischemia-reperfusion injury by reducing inflammation via the miR-6328/IKKβ/NF-κB axis
Journal: J Neuroinflammation | Authors: Yilin Li | Species: rat | Application: WB - Hypothalamic kisspeptin alleviates myasthenia gravis by regulating Th1/Th17/Treg balance through Inhibition of NF-κB signaling pathway
Journal: J Neuroinflammation | Authors: Dan Lu | Species: rat | Application: WB - Monocyte-macrophage SAMHD1 alleviates EAMG by modulating the cGAS-STING pathway.
Journal: J Neuroinflammation | Authors: Wenjun Que | Species: rat,mouse,human | Application: WB - Esketamine alleviates COPD-depression comorbidity in rats via MAPK/NF-κB inhibition and gut-lung-brain axis modulation.
Journal: J Neuroinflammation | Authors: Ang Liu | Species: rat | Application: WB - Monocyte-macrophage SAMHD1 alleviates EAMG by modulating the cGAS-STING pathway.
Journal: J Neuroinflammation | Authors: Wenjun Que | Species: rat,mouse,human | Application: WB - Downregulation of CD151 restricts VCAM-1 mediated leukocyte infiltration to reduce neurobiological injuries after experimental stroke.
Journal: J Neuroinflammation | Authors: Ceshu Gao | Species: mouse | Application: WB - Lung microbiota-mediated biotransformation of mogroside preserves pulmonary barrier integrity and attenuates PM(2.5)-induced inflammation via NF-κB-Th17 modulations.
Journal: NPJ Biofilms Microbiomes | Authors: Kai Wang | Species: chicken | Application: WB - Complement C4b as a key mediator of synaptic loss and cognitive decline in brain aging.
Journal: Mol Ther | Authors: Yi Zheng | Species: mouse | Application: WB - Extracellular vesicle-transmitted miR-671-5p alleviates lung inflammation and injury by regulating the AAK1/NF-κB axis
Journal: Mol Ther | Authors: Jie Lian | Species: human | Application: WB,IP - Exploring the anti-inflammatory effects of Radix Curcumae essential oil in pulmonary sarcoidosis via the TLR4/MyD88/NF-κB pathway
Journal: Phytomedicine | Authors: Zhiguo Mao | Species: mouse | Application: WB - Sanzi Yangqin Decoction improved acute lung injury by regulating the TLR2-mediated NF-κB/NLRP3 signaling pathway and inhibiting the activation of NLRP3 inflammasome
Journal: Phytomedicine | Authors: Anna Gan | Species: mouse | Application: WB - Essential oil from Cinnamomum cassia Presl bark regulates macrophage polarization and ameliorates lipopolysaccharide-induced acute lung injury through TLR4/MyD88/NF-κB pathway
Journal: Phytomedicine | Authors: Fugang Liu | Species: mouse | Application: WB - Integration of transcriptomics and metabolomics reveals the mechanism of Glycyrrhizae Radix Et Rhizoma extract inhibiting CCL5 in the treatment of acute pharyngitis
Journal: Phytomedicine | Authors: Xiaoxiao Han | Species: rat | Application: WB - Cardioprotective effects of polydatin against myocardial injury in HFD/stz and high glucose-induced diabetes via a Caveolin 1-dependent mechanism
Journal: Phytomedicine | Authors: Wenyan Gong | Species: rat,mouse | Application: WB,IHC,IF - Hyperoside ameliorates the progression of osteoarthritis: An in vitro and in vivo study.
Journal: Phytomedicine | Authors: Kai Sun | Species: mouse | Application: WB - Preparation and characterisation of baicalin magnesium and its protective effect in ulcerative colitis via gut microbiota-bile acid axis modulation
Journal: Phytomedicine | Authors: Lin Zhang | Species: mouse | Application: WB - Total saponins from Panax japonicus reduce inflammation in adipocytes through the miR155/SOCS1/NFκB signaling pathway
Journal: Phytomedicine | Authors: Yan Gao | Species: mouse | Application: WB - Schisandra chinensis lignans regulate and cooperate with endogenous cannabinoid systems to ameliorate intestinal barrier injury associated with depression
Journal: Phytomedicine | Authors: Jinyu Wang | Species: human | Application: WB,IF - Ji-Ming-San enhances intestinal circadian rhythms and mitigates colitis in mice: The role of epithelial RORα
Journal: Phytomedicine | Authors: Zhixi Pan | Application: WB - The mechanism of action in Mussaenda pubescens (Yuye Jinhua) against influenza A virus: Evidence from in vitro and in vivo studies
Journal: Phytomedicine | Authors: Jiaona Zhang | Species: mouse | Application: WB - Dual role of Baimao-Longdan-Congrong-Fang in inhibiting Staphylococcus aureus virulence factors and regulating TNF-α/TNFR1/NF-κB/MMP9 axis
Journal: Phytomedicine | Authors: Tao Jiang | Species: mouse | Application: WB - NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes.
Journal: Phytomedicine | Authors: Rui Wang | Species: rat,human | Application: WB,IHC - Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment
Journal: Phytomedicine | Authors: Xiaoyu Tao | Application: WB - Lithocarpus litseifolius and trilobatin ameliorate diabetic nephropathy through alleviating carbonyl stress by inhibiting AGEs/RAGE/NF-κB pathway.
Journal: Phytomedicine | Authors: Xue-Min Chen | Species: mouse,human | Application: WB,IF - Ginseng under forest exerts stronger anti-aging effects compared to garden ginseng probably via regulating PI3K/AKT/mTOR pathway, SIRT1/NF-κB pathway and intestinal flora
Journal: Phytomedicine | Authors: Mingqian Hao | Species: mouse | Application: WB - Total saponins from Panax japonicus reduce inflammation in adipocytes through the miR155/SOCS1/NFκB signaling pathway
Journal: Phytomedicine | Authors: Yan Gao | Species: mouse | Application: WB - Schisandra chinensis lignans regulate and cooperate with endogenous cannabinoid systems to ameliorate intestinal barrier injury associated with depression
Journal: Phytomedicine | Authors: Jinyu Wang | Species: human | Application: WB,IF - Exploring the anti-inflammatory effects of Radix Curcumae essential oil in pulmonary sarcoidosis via the TLR4/MyD88/NF-κB pathway
Journal: Phytomedicine | Authors: Zhiguo Mao | Species: mouse | Application: WB - Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment
Journal: Phytomedicine | Authors: Xiaoyu Tao | Application: WB - Hyperoside ameliorates the progression of osteoarthritis: An in vitro and in vivo study.
Journal: Phytomedicine | Authors: Kai Sun | Species: mouse | Application: WB - NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes.
Journal: Phytomedicine | Authors: Rui Wang | Species: rat,human | Application: WB,IHC - Essential oil from Cinnamomum cassia Presl bark regulates macrophage polarization and ameliorates lipopolysaccharide-induced acute lung injury through TLR4/MyD88/NF-κB pathway
Journal: Phytomedicine | Authors: Fugang Liu | Species: mouse | Application: WB - Ganoderma lucidum polysaccharide peptide (GLPP) attenuates rheumatic arthritis in rats through inactivating NF-κB and MAPK signaling pathways
Journal: Phytomedicine | Authors: Meng Meng | Species: rat | Application: WB - Zhen-wu-tang protects against myocardial fibrosis by inhibiting M1 macrophage polarization via the TLR4/NF-κB pathway
Journal: Phytomedicine | Authors: Rong Fang | Species: mouse | Application: WB - Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment
Journal: Phytomedicine | Authors: Xiaoyu Tao | Application: WB - Zinc-doped carbon dots from natural Isatis Indigotica folium and calamine: SOD/CAT-mimetic activity targets ROS-Ca²⁺-NLRP3 axis for psoriatic dermatitis therapy.
Journal: Phytomedicine | Authors: Xinrong Tian | Species: mouse | Application: WB - Dual role of Baimao-Longdan-Congrong-Fang in inhibiting Staphylococcus aureus virulence factors and regulating TNF-α/TNFR1/NF-κB/MMP9 axis
Journal: Phytomedicine | Authors: Tao Jiang | Species: mouse | Application: WB - Dachengqi decoction ameliorated liver injury in liver fibrosis mice by maintaining gut vascular barrier integrity
Journal: Phytomedicine | Authors: Wang Shuhan | Species: mouse | Application: WB - Ethanolic extract of Arctium lappa leaves alleviates cerebral ischemia reperfusion-induced inflammatory injury via HDAC9-mediated NF-κB pathway
Journal: Phytomedicine | Authors: Mengmeng Wang | Species: rat | Application: WB - Proteomics reveals the pharmacological mechanism of flavonoids from Astragali Complanati Semen in preventing chronic liver injury
Journal: Phytomedicine | Authors: Lin Chen | Species: mouse | Application: WB,IF - Integration of transcriptomics and metabolomics reveals the mechanism of Glycyrrhizae Radix Et Rhizoma extract inhibiting CCL5 in the treatment of acute pharyngitis
Journal: Phytomedicine | Authors: Xiaoxiao Han | Species: rat | Application: WB - Unlocking the gut-lung axis: Feixin decoction as a novel modulator in hypoxic pulmonary hypertension.
Journal: Phytomedicine | Authors: Fei-Ying Wang | Species: rat | Application: WB - Inhibition of toll-like receptor 4 by allicin suppresses mitochondrial DNA-mediated inflammation and pyroptosis to alleviate myocardial ischemia-reperfusion injury.
Journal: Phytomedicine | Authors: Shichao Liang - Herbal-based Xuebijing injection ameliorated vascular endothelial dysfunction via inhibiting ACLY/MYB/RIG-I axis in sepsis-associated lung injury
Journal: Phytomedicine | Authors: Jiayin Cui | Species: human | Application: WB,IF - Qihuang Yishen formula attenuates renal tubular injury by modulating inflammation via the cGAS/STING pathway in diabetic kidney disease.
Journal: Phytomedicine | Authors: Yifan Guo | Species: mouse,human | Application: WB - Theabrownin from Pu-erh Tea Improves DSS-Induced Colitis via Restoring Gut Homeostasis and Inhibiting TLR2&4 Signaling Pathway
Journal: Phytomedicine | Authors: Lei Zhao | Species: mouse | Application: WB - Hyperoside ameliorates the progression of osteoarthritis: An in vitro and in vivo study.
Journal: Phytomedicine | Authors: Kai Sun | Species: mouse | Application: WB - Kaempferitrin attenuates DSS-induced colitis by promoting ubiquitination-mediated degradation of the nuclear factor kappa B p65.
Journal: Phytomedicine | Authors: Ji Cheng | Species: mouse | Application: WB,CoIP - Huangqi Chifeng decoction alleviates cerebral ischemia and reperfusion injury by targeting NFKBIA, NF-κB1 p105 and PIAS1 to multi-dimensionally inhibit NF-κB/NLRP3 signaling: A multi-omics analysis.
Journal: Phytomedicine | Authors: Xiaomin Chen | Species: mouse | Application: WB - Unlocking the gut-lung axis: Feixin decoction as a novel modulator in hypoxic pulmonary hypertension.
Journal: Phytomedicine | Authors: Fei-Ying Wang | Species: rat | Application: WB - Antitumor immunity of alcohol-soluble polysaccharide from Nostoc sphaeroides in non-small cell lung cancer.
Journal: Phytomedicine | Authors: Aobo Wu | Species: human | Application: WB - Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux
Journal: Phytomedicine | Authors: Jianfei Mu | Species: mouse,human | Application: WB - Kaempferitrin attenuates DSS-induced colitis by promoting ubiquitination-mediated degradation of the nuclear factor kappa B p65.
Journal: Phytomedicine | Authors: Ji Cheng | Species: mouse | Application: WB,CoIP - Total saponins from Panax japonicus reduce inflammation in adipocytes through the miR155/SOCS1/NFκB signaling pathway
Journal: Phytomedicine | Authors: Yan Gao | Species: mouse | Application: WB - Palmatine ameliorated lipopolysaccharide-induced sepsis-associated encephalopathy mice by regulating the microbiota-gut-brain axis
Journal: Phytomedicine | Authors: Yubin Xu | Species: mouse | Application: WB,IHC - Antitumor immunity of alcohol-soluble polysaccharide from Nostoc sphaeroides in non-small cell lung cancer.
Journal: Phytomedicine | Authors: Aobo Wu | Species: human | Application: WB - Theabrownin from Pu-erh Tea Improves DSS-Induced Colitis via Restoring Gut Homeostasis and Inhibiting TLR2&4 Signaling Pathway
Journal: Phytomedicine | Authors: Lei Zhao | Species: mouse | Application: WB - Huang-Lian-Jie-Du decoction alleviates diabetic ischemic stroke by modulating gut microbiota-derived short-chain fatty acids.
Journal: Phytomedicine | Authors: Chong Chen | Species: rat | Application: WB - Huang-Lian-Jie-Du decoction alleviates diabetic ischemic stroke by modulating gut microbiota-derived short-chain fatty acids.
Journal: Phytomedicine | Authors: Chong Chen | Species: rat | Application: WB - Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux
Journal: Phytomedicine | Authors: Jianfei Mu | Species: mouse,human | Application: WB - NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes.
Journal: Phytomedicine | Authors: Rui Wang | Species: rat,human | Application: WB,IHC - Rehmannia glutinosa extract inhibits Henoch-Schönlein Purpura (IgA Vasculitis) by restoring regulatory T cell and T helper 17 cell balance via the PI3K/Akt/mTOR signaling pathway.
Journal: Phytomedicine | Authors: Linyan Lang | Species: mouse | Application: WB - Ginsenoside Rh4 alleviates gastrointestinal mucositis and enhances chemotherapy efficacy through modulating gut microbiota
Journal: Phytomedicine | Authors: Xue Bai | Species: mouse | Application: WB - Kaempferitrin attenuates DSS-induced colitis by promoting ubiquitination-mediated degradation of the nuclear factor kappa B p65.
Journal: Phytomedicine | Authors: Ji Cheng | Species: mouse | Application: WB,CoIP - Huang-Lian-Jie-Du decoction alleviates diabetic ischemic stroke by modulating gut microbiota-derived short-chain fatty acids.
Journal: Phytomedicine | Authors: Chong Chen | Species: rat | Application: WB - Cardioprotective effects of polydatin against myocardial injury in HFD/stz and high glucose-induced diabetes via a Caveolin 1-dependent mechanism
Journal: Phytomedicine | Authors: Wenyan Gong | Species: rat,mouse | Application: WB,IHC,IF - Chlorogenic acid targets STING to alleviate pressure overload-induced heart failure and myocardial fibrosis.
Journal: Phytomedicine | Authors: Kai Huang | Species: mouse | Application: WB - Theabrownin from Pu-erh Tea Improves DSS-Induced Colitis via Restoring Gut Homeostasis and Inhibiting TLR2&4 Signaling Pathway
Journal: Phytomedicine | Authors: Lei Zhao | Species: mouse | Application: WB - Huangqi Chifeng decoction alleviates cerebral ischemia and reperfusion injury by targeting NFKBIA, NF-κB1 p105 and PIAS1 to multi-dimensionally inhibit NF-κB/NLRP3 signaling: A multi-omics analysis.
Journal: Phytomedicine | Authors: Xiaomin Chen | Species: mouse | Application: WB - HDAC/NF-κB signaling pathway mediates gut microbiota dysbiosis in rheumatoid arthritis: Intervention mechanisms of Fengshining decoction.
Journal: Phytomedicine | Authors: Ya Wen | Species: mouse | Application: WB - Inhibition of toll-like receptor 4 by allicin suppresses mitochondrial DNA-mediated inflammation and pyroptosis to alleviate myocardial ischemia-reperfusion injury.
Journal: Phytomedicine | Authors: Shichao Liang - Single-cell transcriptome analysis reveals the regulatory effects of artesunate on splenic immune cells in polymicrobial sepsis
Journal: J Pharm Anal | Authors: Jiayun Chen | Species: mouse | Application: WB - Gut microbiome-based thiamine metabolism contributes to the protective effect of one acidic polysaccharide from Selaginella uncinata (Desv.) Spring against inflammatory bowel disease
Journal: J Pharm Anal | Authors: Haochen Hui | Species: mouse,human | Application: WB - Naringenin boosts Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control and heal diabetic foot ulcer.
Journal: J Pharm Anal | Authors: Xin-Meng Zhou | Species: human | Application: WB - Fulminant lung fibrosis in non-resolvable COVID-19 requiring transplantation
Journal: EBioMedicine | Authors: Soma S K Jyothula | Species: human | Application: WB - Oxymatrine, a novel TLR2 agonist, promotes megakaryopoiesis and thrombopoiesis through the STING/NF-κB pathway
Journal: J Pharm Anal | Authors: Chengyang Ni | Species: human | Application: WB - Fulminant lung fibrosis in non-resolvable COVID-19 requiring transplantation
Journal: EBioMedicine | Authors: Soma S K Jyothula | Species: human | Application: WB - Single-cell transcriptome analysis reveals the regulatory effects of artesunate on splenic immune cells in polymicrobial sepsis
Journal: J Pharm Anal | Authors: Jiayun Chen | Species: mouse | Application: WB - A Dihydroartemisinin-Loaded Nanoreactor Motivates Anti-Cancer Immunotherapy by Synergy-Induced Ferroptosis to Activate Cgas/STING for Reprogramming of Macrophage
Journal: Adv Healthc Mater | Authors: Liu-Gen Li | Species: mouse | Application: WB,IF - Polyphenol-based self-assembled nanoparticles treating uveitis by inflammation-oxidative stress suppression
Journal: Mater Today Bio | Authors: Haoxiang Chen | Species: mouse | Application: WB - Pathogen-mimicking Nanoparticles Based on Rigid Nanomaterials as an Efficient Subunit Vaccine Delivery System for Intranasal Iimmunization
Journal: Adv Healthc Mater | Authors: Hongping Wan | Species: mouse | Application: WB - Transdermal Delivery of Icariin via Microneedle Patches Attenuates Phthalate-Induced Testicular Injury.
Journal: Adv Healthc Mater | Authors: Chunyan Fang | Species: rat | Application: WB - Pathogen-mimicking Nanoparticles Based on Rigid Nanomaterials as an Efficient Subunit Vaccine Delivery System for Intranasal Iimmunization
Journal: Adv Healthc Mater | Authors: Hongping Wan | Species: mouse | Application: WB - A Dihydroartemisinin-Loaded Nanoreactor Motivates Anti-Cancer Immunotherapy by Synergy-Induced Ferroptosis to Activate Cgas/STING for Reprogramming of Macrophage
Journal: Adv Healthc Mater | Authors: Liu-Gen Li | Species: mouse | Application: WB,IF - Polyphenol-based self-assembled nanoparticles treating uveitis by inflammation-oxidative stress suppression
Journal: Mater Today Bio | Authors: Haoxiang Chen | Species: mouse | Application: WB - Hyaluronic Acid-based ROS-responsive Multifunctional Injectable Hydrogel Platform Accelerating Diabetic Wound Healing
Journal: Adv Healthc Mater | Authors: Chen Shi | Application: WB,IF - Neutrophil-Delivered Dual Stimuli-Responsive Cisplatin/Quercetin Nanodrugs for Breast Cancer Resistance Reversal.
Journal: Adv Healthc Mater | Authors: Xu Cheng | Species: human | Application: WB,IP,IHC,IF,ELISA,CoIP,ChIP - Intelligent responsive PVA hydrogel loaded with composite MXene nanozyme enables efficient myocardial infarction repair by disrupting the oxidative stress-inflammation cascade.
Journal: Mater Today Bio | Authors: Junran Tong | Species: rat | Application: WB - Intelligent responsive PVA hydrogel loaded with composite MXene nanozyme enables efficient myocardial infarction repair by disrupting the oxidative stress-inflammation cascade.
Journal: Mater Today Bio | Authors: Junran Tong | Species: rat | Application: WB - A Dihydroartemisinin-Loaded Nanoreactor Motivates Anti-Cancer Immunotherapy by Synergy-Induced Ferroptosis to Activate Cgas/STING for Reprogramming of Macrophage
Journal: Adv Healthc Mater | Authors: Liu-Gen Li | Species: mouse | Application: WB,IF - Protective effects of dioscin against alcohol-induced liver injury.
Journal: Arch Toxicol | Authors: Xu Tingting T | Species: rat,mouse | Application: WB - Correction to: Protective effects of dioscin against alcohol‑induced liver injury.
Journal: Arch Toxicol | Authors: Tingting Xu | Species: rat | Application: WB - Multi-omics reveals cholesterol-driven macrophage metabolic reprogramming and inflammation in chronic obstructive pulmonary disease.
Journal: Genome Med | Authors: Xinru Ran | Species: mouse,human | Application: WB - Nicotinamide metabolic dysregulation plays a key role in Benzo[a]pyrene-induced adverse birth outcomes: Evidence from multi-omics profiling, experimental and epidemiological validation.
Journal: J Hazard Mater | Authors: Nan Zhao | Species: mouse | Application: WB - Nicotinamide metabolic dysregulation plays a key role in Benzo[a]pyrene-induced adverse birth outcomes: Evidence from multi-omics profiling, experimental and epidemiological validation.
Journal: J Hazard Mater | Authors: Nan Zhao | Species: mouse | Application: WB - GRP78/IRE1 and cGAS/STING pathway crosstalk through CHOP facilitates iodoacetic acid-mediated testosterone decline
Journal: J Hazard Mater | Authors: Li Mou | Species: rat | Application: WB - Site-specific Atg13 methylation-mediated autophagy regulates epithelial inflammation in PM2.5-induced pulmonary fibrosis
Journal: J Hazard Mater | Authors: Jie Ning | Species: mouse | Application: WB - METTL3 overexpression aggravates LPS-induced cellular inflammation in mouse intestinal epithelial cells and DSS-induced IBD in mice.
Journal: Cell Death Discov | Authors: Lichao Yang | Application: WB - Adhesive hydrogel releases protocatechualdehyde-Fe3+ complex to promote three healing stages for accelerated therapy of oral ulcers
Journal: Acta Biomater | Authors: Yue Wang | Species: mouse | Application: WB - A hydrogel-based drug delivery system reduces inflammation and oxidative stress to alleviate intervertebral disc degeneration.
Journal: Acta Biomater | Authors: Siya Wang | Species: rat | Application: WB - Activating Macrophages for Enhanced Osteogenic and Bactericidal performance by Cu Ion Release from Micro/Nano-Topographical Coating on Titanium Substrate.
Journal: Acta Biomater | Authors: Qianli Huang | Species: mouse | Application: WB - Nuclear iASPP determines cell fate by selectively inhibiting either p53 or NF-κB.
Journal: Cell Death Discov | Authors: Wenjie Ge | Species: human | Application: WB - Circular RNA circDhx32 promotes cardiac inflammatory responses in mouse cardiac ischemia-reperfusion injury via binding to FOXO1 competed with AdipoR1
Journal: Acta Pharmacol Sin | Authors: Wei Si | Species: human | Application: WB - Ammonium tetrathiomolybdate relieves oxidative stress in cisplatin-induced acute kidney injury via NRF2 signaling pathway
Journal: Cell Death Discov | Authors: Hao Qi | Species: human | Application: WB - G protein-coupled receptor kinase 2 as a novel therapeutic target for gland fibrosis of Sjögren's syndrome
Journal: Acta Pharmacol Sin | Authors: Ru-Hong Fang | Species: mouse | Application: IF - Tert promotes cardiac regenerative repair after MI through alleviating ROS-induced DNA damage response in cardiomyocyte
Journal: Cell Death Discov | Authors: Xiaomin Wei | Species: mouse | Application: WB - Nuclear iASPP determines cell fate by selectively inhibiting either p53 or NF-κB.
Journal: Cell Death Discov | Authors: Wenjie Ge | Species: human | Application: WB - Inhibition of TRADD ameliorates chondrocyte necroptosis and osteoarthritis by blocking RIPK1-TAK1 pathway and restoring autophagy
Journal: Cell Death Discov | Authors: Kai Sun | Species: human | Application: WB - G protein-coupled receptor kinase 2 as a novel therapeutic target for gland fibrosis of Sjögren's syndrome
Journal: Acta Pharmacol Sin | Authors: Ru-Hong Fang | Species: mouse | Application: IF - Ammonium tetrathiomolybdate relieves oxidative stress in cisplatin-induced acute kidney injury via NRF2 signaling pathway
Journal: Cell Death Discov | Authors: Hao Qi | Species: human | Application: WB - Tert promotes cardiac regenerative repair after MI through alleviating ROS-induced DNA damage response in cardiomyocyte
Journal: Cell Death Discov | Authors: Xiaomin Wei | Species: mouse | Application: WB - Circular RNA circDhx32 promotes cardiac inflammatory responses in mouse cardiac ischemia-reperfusion injury via binding to FOXO1 competed with AdipoR1
Journal: Acta Pharmacol Sin | Authors: Wei Si | Species: human | Application: WB - 17β-estradiol alleviated ferroptotic neuroinflammation by suppressing ATF4 in mouse model of Parkinson's disease
Journal: Cell Death Discov | Authors: Guoming Wang | Species: rat,mouse | Application: WB - Aspirin modulates succinylation of PGAM1K99 to restrict the glycolysis through NF-κB/HAT1/PGAM1 signaling in liver cancer.
Journal: Acta Pharmacol Sin | Authors: Yu-Fei Wang | Species: human | Application: WB,ChIP - Tert promotes cardiac regenerative repair after MI through alleviating ROS-induced DNA damage response in cardiomyocyte
Journal: Cell Death Discov | Authors: Xiaomin Wei | Species: mouse | Application: WB - Harmine is an effective therapeutic small molecule for the treatment of cardiac hypertrophy.
Journal: Acta Pharmacol Sin | Authors: Jie Huang | Species: Rat - Extracellular vesicles derived from bone marrow mesenchymal stem cells regulate SREBF2/HMGB1 axis by transporting miR-378a-3p to inhibit ferroptosis in intestinal ischemia-reperfusion injury
Journal: Cell Death Discov | Authors: Zan Liu | Species: mouse,human | Application: WB - IDO1 facilitates esophageal carcinoma progression by driving the direct binding of NF-κB and CXCL10
Journal: Cell Death Discov | Authors: Wenjian Yao | Species: human | Application: WB - GSDMD promotes neutrophil extracellular traps via mtDNA-cGAS-STING pathway during lung ischemia/reperfusion
Journal: Cell Death Discov | Authors: Chen Zhao | Species: mouse | Application: WB - Bisphenol P exposure in C57BL/6 mice caused gut microbiota dysbiosis and induced intestinal barrier disruption via LPS/TLR4/NF-κB signaling pathway
Journal: Environ Int | Authors: Nana Ma | Species: mouse | Application: WB - Synergistic disruption of blood-brain barrier and neuroimmune homeostasis by sleep-related environmental pollutants drives sleep disorders: an integrated computational and experimental study.
Journal: Environ Int | Authors: Kehao Liu - Polystyrene microplastics induce anxiety via HRAS derived PERK-NF-κB pathway
Journal: Environ Int | Authors: Guanjun Li | Species: mouse | Application: WB - PFOS impairs cardiac function and energy metabolism under high-fat diet: Insights into role of circulating macrophage emphasized by exposure distribution
Journal: Sci Total Environ | Authors: Ze Zhang | Species: mouse | Application: WB,IF - Glycidol induces necroptosis and inflammation through autophagy-necrosome pathway in renal cell and mice
Journal: Sci Total Environ | Authors: Jing Lu | Species: rat,mouse | Application: WB - Linear ubiquitination of LKB1 activates AMPK pathway to inhibit NLRP3 inflammasome response and reduce chondrocyte pyroptosis in osteoarthritis
Journal: J Orthop Translat | Authors: Yang Chen | Species: rat | Application: WB - Sirt1 blocks nucleus pulposus and macrophages crosstalk by inhibiting RelA/Lipocalin 2 axis
Journal: J Orthop Translat | Authors: Yi-Fan Wei | Species: mouse | Application: ChIP - Glycidol induces necroptosis and inflammation through autophagy-necrosome pathway in renal cell and mice
Journal: Sci Total Environ | Authors: Jing Lu | Species: rat,mouse | Application: WB - Prunella vulgaris seed oil alleviates cancer related fatigue through hypothalamic inflammation and CRH regulation
Journal: NPJ Sci Food | Authors: Changyu Wu | Species: mouse | Application: WB - CEBPD-mediated SGPP2 upregulation via PERK/ER stress in endothelial cells disrupts S1P homeostasis and impairs angiogenesis in chronic endometritis.
Journal: J Transl Med | Authors: Yanjun Wang | Species: human | Application: WB - METTL3-mediated m(6)A modification of lncRNA MALAT1 promotes colorectal cancer progression by activating the NF-κB signaling pathway.
Journal: J Transl Med | Authors: Shuangming Lin | Species: human | Application: IHC - FAM135B suppresses glioblastoma angiogenesis via stabilizing the IKK complex and inactivating the NF-κB/IL-6 signaling pathway.
Journal: J Transl Med | Authors: Chuangyuan Wang | Species: human | Application: WB - Prunella vulgaris seed oil alleviates cancer related fatigue through hypothalamic inflammation and CRH regulation
Journal: NPJ Sci Food | Authors: Changyu Wu | Species: mouse | Application: WB - Bioinformatics analysis and experimental validation of potential targets and pathways in chronic kidney disease associated with renal fibrosis
Journal: J Transl Med | Authors: Cui Huimin | Species: human | Application: IF - Harm of circadian misalignment to the hearts of the adolescent wistar rats.
Journal: J Transl Med | Authors: YunLei Wang | Species: rat | Application: IHC - Lactobacillus-derived indole-3-lactic acid suppresses meningioma malignant phenotypes by direct anti-proliferative effects and macrophage reprogramming.
Journal: J Transl Med | Authors: Shucai Jiang | Species: human | Application: WB - SCAP Interacts with Trim27 to Promote Vascular Neointimal Hyperplasia by Regulating the Stability and Ubiquitination of IκBα.
Journal: Aging Dis | Authors: Yaxi Chen | Species: mouse,human | Application: WB - SCAP Interacts with Trim27 to Promote Vascular Neointimal Hyperplasia by Regulating the Stability and Ubiquitination of IκBα.
Journal: Aging Dis | Authors: Yaxi Chen | Species: mouse,human | Application: WB - Porcine GWAS identifies ACOT11 as regulator for macrophage IL-1β maturation via IFNGR2 palmitoylation
Journal: Sci China Life Sci | Authors: Meimei Zhang | Species: mouse | Application: WB,ChIP - SUB1 promotes colorectal cancer metastasis by activating NF-κB signaling via UBR5-mediated ubiquitination of UBXN1
Journal: Sci China Life Sci | Authors: Hao Wang | Species: mouse,human | Application: WB,IHC,IF,CoIP - Repression of eEF2K transcription by NF-κB tunes translation elongation to inflammation and dsDNA-sensing.
Journal: Proc Natl Acad Sci U S A | Authors: Christopher Bianco | Species: human | Application: WB - Macrophage SHP2 Deficiency Alleviates Diabetic Nephropathy via Suppression of MAPK/NF-κB- Dependent Inflammation
Journal: Diabetes | Authors: Xue Han | Species: mouse | Application: WB,IF - Application of Dental Pulp Stem Cell-Derived Intracellular Vesicles for Diabetic Wound Healing.
Journal: Diabetes | Authors: Pengcheng Pang | Species: mouse,human | Application: WB - DTX3 promotes anti-tumor immunity by inducing PD-L1 ubiquitination and is suppressed by p65/miR-222 in bladder cancer.
Journal: Oncogene | Authors: Yu Cheng - GADD45B promotes apoptosis in intestinal ischemia/reperfusion through DNA demethylation of MST1/Hippo.
Journal: Chin Med J (Engl) | Authors: Fengyuan Yang | Species: mouse,human | Application: WB - AKIP1 accelerates glioblastoma progression through stabilizing EGFR expression
Journal: Oncogene | Authors: Sicheng Wan | Species: human | Application: WB - FGD3 binds with HSF4 to suppress p65 expression and inhibit pancreatic cancer progression.
Journal: Oncogene | Authors: Feng Guo | Species: human | Application: WB,IHC - Deacetylation of tumor-suppressor MST1 in Hippo pathway induces its degradation through HBXIP-elevated HDAC6 in promotion of breast cancer growth.
Journal: Oncogene | Authors: L Li | Species: human | Application: WB - The HEAT repeat protein MROH7 regulates the inflammatory macrophage response via LBP acetylation
Journal: Cell Chem Biol | Authors: Hangchao Zhang - Repurposing simeprevir uncovers a druggable KPNB1-p65-BCL2 survival axis in cancer.
Journal: Cell Chem Biol | Authors: Cong Li - The anti-inflammatory potential of protein-bound anthocyanin compounds from purple sweet potato in LPS-induced RAW264.7 macrophages.
Journal: Food Res Int | Authors: Tian Jiang | Species: mouse | Application: WB - Prunus persica (L.) Batsch blossom soluble dietary fiber synergia polyphenol improving loperamide-induced constipation in mice via regulating stem cell factor/C-kit, NF-κB signaling pathway and gut microbiota
Journal: Food Res Int | Authors: Shan Liang | Species: mouse | Application: WB - Ginsenoside Rk1 Ameliorates Non-Alcoholic Fatty Liver Disease by Targeting CD36 to Modulate the AMPK Signaling Pathway
Journal: Food Res Int | Authors: Yuqing Wu | Species: mouse | Application: WB - Antarctic krill oil Pickering emulsions stabilized by zein/sodium caseinate-xanthan gum nanoparticles: stability, bioaccessibility, and anti-inflammatory activity.
Journal: Food Res Int | Authors: Yan Zeng | Species: mouse | Application: WB - The anti-inflammatory effect of vasoactive peptides from soybean protein hydrolysates by mediating serum extracellular vesicles-derived miRNA-19b/CYLD/TRAF6 axis in the vascular microenvironment of SHRs
Journal: Food Res Int | Authors: Tianyuan Song | Species: human | Application: WB - MicroRNA-21 Knockout Exacerbates Angiotensin II-Induced Thoracic Aortic Aneurysm and Dissection in Mice With Abnormal Transforming Growth Factor-β-SMAD3 Signaling.
Journal: Arterioscler Thromb Vasc Biol | Authors: Xiaofan Huang | Species: mouse | Application: IHC - Prunus persica (L.) Batsch blossom soluble dietary fiber synergia polyphenol improving loperamide-induced constipation in mice via regulating stem cell factor/C-kit, NF-κB signaling pathway and gut microbiota
Journal: Food Res Int | Authors: Shan Liang | Species: mouse | Application: WB - WIPButyrate produced by the Lycium ruthenicum polysaccharide alleviated sleep deprivation-induced chronic fatigue syndrome in mice through promoting microglial autophagy.
Journal: Food Res Int | Authors: Xinyuan Wang | Species: mouse | Application: WB - Phosphorylation-driven regulation of SIRT1 in muscle senescence: Insights from molecular dynamics simulation and experimental validation
Journal: Int J Biol Macromol | Authors: Siyao Liu | Species: mouse | Application: WB - The hsa_circ_0082152 maintains NF-κB mRNA stability by binding to MTDH to promote anti-tuberculosis drug-induced liver injury
Journal: Int J Biol Macromol | Authors: Lin Wang | Species: human | Application: WB - Bletilla striata polysaccharide (BSP) promotes hair growth and suppresses oxidative stress and senescence of dermal papilla cells by inhibiting prostaglandin-endoperoxide synthase 2 (PTGS2).
Journal: Int J Biol Macromol | Authors: Youming Huang | Species: mouse,human | Application: WB - Structure characterization and immunological activity of capsular polysaccharide from live and heat-killed Lacticaseibacillus paracasei 6235
Journal: Int J Biol Macromol | Authors: Yucong Wang | Species: mouse | Application: WB,IF - Exosome Derived from Mesenchymal Stem Cells Alleviates Hypertrophic Scar by Inhibiting the Fibroblasts via TNFSF-13/HSPG2 Signaling Pathway
Journal: Int J Nanomedicine | Authors: Huimin Zhang | Species: human | Application: WB,IHC,IF - Botulinum toxin type A inhibits microglia pyroptosis by suppressing Cblb-mediated degradation of Pdlim1 to attenuate neuropathic pain.
Journal: J Headache Pain | Authors: Sheng Tian | Species: mouse | Application: WB - Immune regulation and inflammation inhibition of Arctium lappa L. polysaccharides by TLR4/NF-κB signaling pathway in cells
Journal: Int J Biol Macromol | Authors: Feng Zeng | Species: mouse,human | Application: WB - Construction of a permeation-promoting repair emulsion based on gum arabic/β-cyclodextrin microencapsulation stabilized peony seed oil and investigation of its mechanism for photodamage repair.
Journal: Int J Biol Macromol | Authors: Shuang Guo | Species: mouse | Application: WB - Inhibition of S100A4 decreases neurotoxic astrocyte reactivity and attenuates neuropathic pain via the TLR4/NF-κB pathway in a rat model of spinal nerve ligation
Journal: J Headache Pain | Authors: Tao Xue | Species: rat | Application: WB - Chitosan-based self-healing thermosensitive hydrogel loaded with siHMGB1 for treatment of rheumatoid arthritis via macrophage repolarization
Journal: Int J Biol Macromol | Authors: Lixing Xu | Species: rat,mouse | Application: WB - Structural characterization of an apple polysaccharide and its anti-inflammatory effect through suppressing TLR4/NF-κB signaling
Journal: Int J Biol Macromol | Authors: Shanbo Ma | Species: mouse | Application: WB - Resveratrol alleviates lipopolysaccharide-induced acute lung injury through blocking the excessive autophagy/mitophagy via SIRT1/PGC-1α and TNF/NF-κB/JNK pathways
Journal: Int J Biol Macromol | Authors: Huari Li | Species: rat | Application: WB - Eicosapentaenoic acid (EPA) reduced lipopolysaccharide-stimulated inflammatory response of RAW264.7 cells via the miR-125b-5p/CREB axis
Journal: Int J Biol Macromol | Authors: Liyuan Zhang | Species: mouse | Application: WB - NR1D1 activation alleviates inflammatory response through inhibition of IL-6 expression in bovine endometrial epithelial cells
Journal: Int J Biol Macromol | Authors: Wanghao Yang | Species: bovine | Application: WB - Portulaca oleracea polysaccharide alleviates UVB-induced solar dermatitis in association with macrophage immunomodulation.
Journal: Int J Biol Macromol | Authors: Wenxi Yu - Immunological activity of peach pectins: Insights from cells to animals.
Journal: Int J Biol Macromol | Authors: Meng Liu | Species: mouse | Application: WB - Crucial role of low molecular weight chondroitin sulfate from hybrid sturgeon cartilage in osteoarthritis improvement: Focusing on apoptosis, systemic inflammation, and intestinal flora
Journal: Int J Biol Macromol | Authors: Yinghuan Jing | Species: mouse | Application: WB - Amelioration of obesity and inflammation by polysaccharide from unripe fruits of raspberry via gut microbiota regulation
Journal: Int J Biol Macromol | Authors: Yuzhe Huang | Species: mouse | Application: IHC - Enhancement of Psoriasis Treatment by Phellodendri Chinensis Cortex Carbon Dots (PCC-CDs) Through Modulation of the HMGB1/TLR4/MAPK/NF-κB Pathway.
Journal: Int J Nanomedicine | Authors: Xinrong Tian | Species: mouse | Application: WB - The β-glucan from Lentinus alleviates UVB-induced dermal fibroblasts senescence and skin photoaging
Journal: Int J Biol Macromol | Authors: Kang Wei | Application: WB - Preparation of nanocomposite membranes loaded with taxifolin liposome and its mechanism of wound healing in diabetic mice
Journal: Int J Biol Macromol | Authors: Qiteng Ding | Species: mouse | Application: WB - Unexpected Inhibitory Role of Silica Nanoparticles on Lung Cancer Development by Promoting M1 Polarization of Macrophages
Journal: Int J Nanomedicine | Authors: Meng Xiang | Species: mouse | Application: WB - Lauric acid-mediated gelatin/hyaluronic acid composite hydrogel with effective antibacterial and immune regulation for accelerating MRSA-infected diabetic wound healing
Journal: Int J Biol Macromol | Authors: Jian Yang | Species: rat | Application: WB - NR1D1 activation alleviates inflammatory response through inhibition of IL-6 expression in bovine endometrial epithelial cells
Journal: Int J Biol Macromol | Authors: Wanghao Yang | Species: bovine | Application: WB - Eicosapentaenoic acid (EPA) reduced lipopolysaccharide-stimulated inflammatory response of RAW264.7 cells via the miR-125b-5p/CREB axis
Journal: Int J Biol Macromol | Authors: Liyuan Zhang | Species: mouse | Application: WB - A phellinus igniarius polysaccharide/chitosan-arginine hydrogel for promoting diabetic wound healing
Journal: Int J Biol Macromol | Authors: Lifeng Zhang | Species: mouse | Application: WB - λ-Carrageenan regulates antiviral responses by targeting classical NF-κB and IRF3-mediated signaling pathways.
Journal: Int J Biol Macromol | Authors: Xueke Sun | Species: mouse | Application: WB - Amelioration of obesity and inflammation by polysaccharide from unripe fruits of raspberry via gut microbiota regulation
Journal: Int J Biol Macromol | Authors: Yuzhe Huang | Species: mouse | Application: IHC - Hyaluronic acid-modified PtPdCo-CQ nanocatalyst with triple enzyme-like activities regulates macrophage polarization and autophagy levels for the treatment of rheumatoid arthritis
Journal: Int J Biol Macromol | Authors: Lei Zhang | Species: mouse | Application: WB - Exosome Derived from Mesenchymal Stem Cells Alleviates Pathological Scars by Inhibiting the Proliferation, Migration and Protein Expression of Fibroblasts via Delivering miR-138-5p to Target SIRT1
Journal: Int J Nanomedicine | Authors: Wen Zhao | Species: human | Application: WB - VSIG4 inhibits RANKL-induced osteoclastogenesis by enhancing Nrf2-dependent antioxidant response against reactive oxygen species production
Journal: Int J Biol Macromol | Authors: Jiansen Miao | Species: mouse | Application: WB - Regulation of macrophage phenotypes via NF-κB/NLRP3 and HIF1α/p53 pathways by fuco-galactoglucan from Agrocybe aegerita.
Journal: Int J Biol Macromol | Authors: Xiaojun Li | Species: mouse | Application: WB - Eicosapentaenoic acid (EPA) reduced lipopolysaccharide-stimulated inflammatory response of RAW264.7 cells via the miR-125b-5p/CREB axis
Journal: Int J Biol Macromol | Authors: Liyuan Zhang | Species: mouse | Application: WB - Regulation of macrophage phenotypes via NF-κB/NLRP3 and HIF1α/p53 pathways by fuco-galactoglucan from Agrocybe aegerita.
Journal: Int J Biol Macromol | Authors: Xiaojun Li | Species: mouse | Application: WB - Crucial role of low molecular weight chondroitin sulfate from hybrid sturgeon cartilage in osteoarthritis improvement: Focusing on apoptosis, systemic inflammation, and intestinal flora
Journal: Int J Biol Macromol | Authors: Yinghuan Jing | Species: mouse | Application: WB - Recombinant humanized collagen remodels endometrial immune microenvironment of chronic endometritis through macrophage immunomodulation
Journal: Regen Biomater | Authors: Shuang You | Species: human | Application: WB - Inhibition of S100A4 decreases neurotoxic astrocyte reactivity and attenuates neuropathic pain via the TLR4/NF-κB pathway in a rat model of spinal nerve ligation
Journal: J Headache Pain | Authors: Tao Xue | Species: rat | Application: WB - A phellinus igniarius polysaccharide/chitosan-arginine hydrogel for promoting diabetic wound healing
Journal: Int J Biol Macromol | Authors: Lifeng Zhang | Species: mouse | Application: WB - Bombyx mori Akirin hijacks a viral peptide vSP27 encoded by BmCPV circRNA and activates the ROS-NF-κB pathway against viral infection.
Journal: Int J Biol Macromol | Authors: Yunshan Zhang | Species: Bombyx mori | Application: WB - Bombyx mori Akirin hijacks a viral peptide vSP27 encoded by BmCPV circRNA and activates the ROS-NF-κB pathway against viral infection.
Journal: Int J Biol Macromol | Authors: Yunshan Zhang | Species: Bombyx mori | Application: WB - Hyaluronic acid-modified PtPdCo-CQ nanocatalyst with triple enzyme-like activities regulates macrophage polarization and autophagy levels for the treatment of rheumatoid arthritis
Journal: Int J Biol Macromol | Authors: Lei Zhang | Species: mouse | Application: WB - Resveratrol alleviates lipopolysaccharide-induced acute lung injury through blocking the excessive autophagy/mitophagy via SIRT1/PGC-1α and TNF/NF-κB/JNK pathways
Journal: Int J Biol Macromol | Authors: Huari Li | Species: rat | Application: WB - Phosphorylation-driven regulation of SIRT1 in muscle senescence: Insights from molecular dynamics simulation and experimental validation
Journal: Int J Biol Macromol | Authors: Siyao Liu | Species: mouse | Application: WB - Unexpected Inhibitory Role of Silica Nanoparticles on Lung Cancer Development by Promoting M1 Polarization of Macrophages
Journal: Int J Nanomedicine | Authors: Meng Xiang | Species: mouse | Application: WB - Lipopolysaccharide-induced persistent inflammation ameliorates fat accumulation by promoting adipose browning in vitro and in vivo
Journal: Int J Biol Macromol | Authors: Wenkai Zhang | Species: mouse | Application: WB - Pyrroloquinoline quinone attenuates isoproterenol hydrochloride‑induced cardiac hypertrophy in AC16 cells by inhibiting the NF‑κB signaling pathway.
Journal: Int J Mol Med | Authors: Junru Wen | Species: human | Application: WB - Correlation between the expression of IL‑18 and deep venous thrombosis.
Journal: Int J Mol Med | Authors: Guangdi Li | Species: rat | Application: WB - Ruxolitinib improves the inflammatory microenvironment, restores glutamate homeostasis, and promotes functional recovery after spinal cord injury
Journal: Neural Regen Res | Authors: Jiang Cao | Species: mouse | Application: WB - Scutellarein inhibits cancer cell metastasis in vitro and attenuates the development of fibrosarcoma in vivo.
Journal: Int J Mol Med | Authors: Xiujuan Shi | Species: human - Dihydroartemisinin attenuates lipopolysaccharide‑induced acute lung injury in mice by suppressing NF‑κB signaling in an Nrf2‑dependent manner.
Journal: Int J Mol Med | Authors: Xiao-Ting Huang | Species: mouse | Application: WB - Suppressive effect mediated by human adipose-derived stem cells on T cells involves the activation of JNK.
Journal: Int J Mol Med | Authors: Yinmin Wang | Species: human | Application: WB - Suppressive effect mediated by human adipose-derived stem cells on T cells involves the activation of JNK.
Journal: Int J Mol Med | Authors: Yinmin Wang | Species: human | Application: WB - Dihydroartemisinin attenuates lipopolysaccharide‑induced acute lung injury in mice by suppressing NF‑κB signaling in an Nrf2‑dependent manner.
Journal: Int J Mol Med | Authors: Xiao-Ting Huang | Species: mouse | Application: WB - PINK1 overexpression suppresses p38 MAPK/NF‑κB signaling to attenuate chondrocyte senescence in osteoarthritis.
Journal: Int J Mol Med | Authors: Lishi Jie | Species: mouse,human | Application: WB - Scutellarein inhibits cancer cell metastasis in vitro and attenuates the development of fibrosarcoma in vivo.
Journal: Int J Mol Med | Authors: Xiujuan Shi | Species: human - Curcumenol inhibits malignant progression and promotes ferroptosis via the SLC7A11/NF‑κB/TGF‑β pathway in triple‑negative breast cancer
Journal: Int J Mol Med | Authors: Feifei Li | Species: human | Application: WB - Correlation between the expression of IL‑18 and deep venous thrombosis.
Journal: Int J Mol Med | Authors: Guangdi Li | Species: rat | Application: WB - Metabotropic signaling downstream of GABA(A) receptors suppresses neuroinflammation in Parkinson's disease.
Journal: NPJ Parkinsons Dis | Authors: Wenjing Lu - Dihydroartemisinin attenuates lipopolysaccharide‑induced acute lung injury in mice by suppressing NF‑κB signaling in an Nrf2‑dependent manner.
Journal: Int J Mol Med | Authors: Xiao-Ting Huang | Species: mouse | Application: WB - NRF1-mediated mitochondrial biogenesis antagonizes innate antiviral immunity
Journal: EMBO J | Authors: Tian Zhao | Species: mouse,human | Application: WB - The p53-inducible long noncoding RNA TRINGS protects cancer cells from necrosis under glucose starvation.
Journal: EMBO J | Authors: Muhammad Riaz Khan | Species: human | Application: WB - Age-related decline in melatonin contributes to enhanced osteoclastogenesis via disruption of redox homeostasis
Journal: Mol Med | Authors: Di-Zheng Wu | Species: mouse | Application: WB - Plant essential oils combined with organic acids restored lipopolysaccharide-induced leaky intestine via gut microbial modulation in weaned piglets
Journal: Anim Nutr | Authors: Xiaoyu Zheng | Species: pig | Application: WB - AGEs promote atherosclerosis by increasing LDL transcytosis across endothelial cells via RAGE/NF-κB/Caveolin-1 pathway
Journal: Mol Med | Authors: Meng Shu | Species: mouse,human | Application: WB,IHC,IF - Plant essential oils combined with organic acids restored lipopolysaccharide-induced leaky intestine via gut microbial modulation in weaned piglets
Journal: Anim Nutr | Authors: Xiaoyu Zheng | Species: pig | Application: WB - The impact of combined thymol and rosmarinic acid on the intestinal microbiota and barrier function of the piglets challenged by Escherichia coli K88
Journal: Anim Nutr | Authors: Runlin Li | Species: pig | Application: WB - Dietary sanguinarine supplementation improves the growth performance and intestinal immunity of broilers
Journal: Anim Nutr | Authors: Yue Su | Species: chicken | Application: WB - Salvianolic Acid A Protects against Acetaminophen-Induced Hepatotoxicity via Regulation of the miR-485-3p/SIRT1 Pathway
Journal: Antioxidants (Basel) | Authors: Fan Tang | Species: mouse | Application: WB - Dietary Protease Supplementation Improved Growth Performance and Nutrients Digestion via Modulating Intestine Barrier, Immunological Response, and Microbiota Composition in Weaned Piglets
Journal: Antioxidants (Basel) | Authors: Tao Liu | Species: pig | Application: WB - Imidacloprid induces abnormal glucose metabolism through NF-κB-mediated apoptosis of pancreatic β cells based on population exposure levels.
Journal: Environ Res | Authors: Zhongyuan Zhang | Species: mouse | Application: WB - Salvianolic Acid A Protects against Acetaminophen-Induced Hepatotoxicity via Regulation of the miR-485-3p/SIRT1 Pathway
Journal: Antioxidants (Basel) | Authors: Fan Tang | Species: mouse | Application: WB - Parthenolide Restores Testosterone Biosynthesis After Nanoplastic Exposure by Blocking ROS-Driven NF-κB Nuclear Translocation.
Journal: Antioxidants (Basel) | Authors: Peng Zhao | Species: mouse | Application: WB,IF - Transcriptotype-Driven Discovery of Apigenin as a Therapy against Cholestatic Liver Fibrosis: Through Inhibition of PANoptosis and Following Type-I Interferon Responses
Journal: Antioxidants (Basel) | Authors: Shuni Duan | Species: mouse | Application: WB - A Novel Function of Glycerol Kinase Alleviates LPS-Induced Inflammatory Responses by the p38/STAT3 Pathway and Mitigates ROS Generation in Kupffer Cells.
Journal: Antioxidants (Basel) | Authors: Yanfei Li | Species: mouse | Application: WB - Hydrogen Sulfide Attenuates Aortic Remodeling in Aortic Dissection Associating with Moderated Inflammation and Oxidative Stress through a NO-Dependent Pathway.
Journal: Antioxidants (Basel) | Authors: Hsin-Ying Lu | Species: mouse | Application: WB - Isoorientin Attenuated the Pyroptotic Hepatocyte Damage Induced by Benzo[a]pyrene via ROS/NF-κB/NLRP3/Caspase-1 Signaling Pathway.
Journal: Antioxidants (Basel) | Authors: Hao Li | Species: human | Application: WB - Oral administration of punicalagin attenuates imiquimod-induced psoriasis by reducing ROS generation and inflammation via MAPK/ERK and NF-κB signaling pathways
Journal: Phytother Res | Authors: Yuqian Wang | Species: human | Application: WB - Gastrodin Ameliorates Tau Pathology and BBB Dysfunction in 3xTg-AD Transgenic Mice by Regulating the ADRA1/NF-κB/NLRP3 Pathway to Reduce Neuroinflammation
Journal: Phytother Res | Authors: Bo Li | Species: mouse | Application: WB - Sclareol ameliorates hyperglycemia-induced renal injury through inhibiting the MAPK/NF-κB signaling pathway.
Journal: Phytother Res | Authors: Xue Han | Species: mouse | Application: WB,IF - Hesperidin Inhibits Oxidative Stress and Apoptosis of Granulosa Cells in Polycystic Ovarian Syndrome Through the JAK2/STAT3 and PI3K/AKT Pathways
Journal: Phytother Res | Authors: Qixuan Zhang | Species: human | Application: WB - Proteomic and metabolomic approaches elucidate the molecular mechanism of emodin against neuropathic pain through modulating the gamma-aminobutyric acid (GABA)-ergic pathway and PI3K/AKT/NF-κB pathway
Journal: Phytother Res | Authors: Peng Chen | Species: rat | Application: WB - Therapeutic potential of isobavachalcone, a natural flavonoid, in murine experimental colitis by inhibiting NF-κB p65.
Journal: Phytother Res | Authors: Yishan Zhou | Species: mouse | Application: WB - Pterostilbene could alleviate diabetic cognitive impairment by suppressing TLR4/NF-кB pathway through microbiota-gut-brain axis
Journal: Phytother Res | Authors: Zhi-Tong Zhang | Species: mouse | Application: WB - Oral administration of punicalagin attenuates imiquimod-induced psoriasis by reducing ROS generation and inflammation via MAPK/ERK and NF-κB signaling pathways
Journal: Phytother Res | Authors: Yuqian Wang | Species: human | Application: WB - Hesperidin Inhibits Oxidative Stress and Apoptosis of Granulosa Cells in Polycystic Ovarian Syndrome Through the JAK2/STAT3 and PI3K/AKT Pathways
Journal: Phytother Res | Authors: Qixuan Zhang | Species: human | Application: WB - Baicalin ameliorates high fat diet-induced nonalcoholic fatty liver disease in mice via adenosine monophosphate-activated protein kinase-mediated regulation of SREBP1/Nrf2/NF-κB signaling pathways
Journal: Phytother Res | Authors: Yanxia Gao | Species: mouse | Application: WB - Proteomic and metabolomic approaches elucidate the molecular mechanism of emodin against neuropathic pain through modulating the gamma-aminobutyric acid (GABA)-ergic pathway and PI3K/AKT/NF-κB pathway
Journal: Phytother Res | Authors: Peng Chen | Species: rat | Application: WB - Oral administration of punicalagin attenuates imiquimod-induced psoriasis by reducing ROS generation and inflammation via MAPK/ERK and NF-κB signaling pathways
Journal: Phytother Res | Authors: Yuqian Wang | Species: human | Application: WB - Exosomal RBP4 potentiated hepatic lipid accumulation and inflammation in high-fat-diet-fed mice by promoting M1 polarization of Kupffer cells
Journal: Free Radic Biol Med | Authors: Jin-Mei Yao | Species: human | Application: WB - Cold atmospheric plasma conveys selectivity on triple negative breast cancer cells both in vitro and in vivo.
Journal: Free Radic Biol Med | Authors: Liangjian Xiang | Species: human | Application: WB - Hepatocyte-derived Fetuin-A promotes alcohol-associated liver disease in mice by inhibiting autophagy-lysosome degradation of TLR and M2 macrophage polarization
Journal: Free Radic Biol Med | Authors: Shibang Lu | Species: mouse | Application: WB - Bovine serum albumin-coated metal-phenolic nanoplatform for atherosclerosis therapy via targeted delivery and inhibition of vascular smooth muscle cells proliferation.
Journal: Free Radic Biol Med | Authors: Na Li | Species: rat | Application: WB - Astragalin alleviates lipopolysaccharide-induced depressive-like behavior in mice by preserving blood-brain barrier integrity and suppressing neuroinflammation
Journal: Free Radic Biol Med | Authors: Min-Min Cao | Species: mouse | Application: WB - TRIM25 triggers pyroptosis through mitochondrial DNA release in intestinal ischemia-reperfusion injury.
Journal: Free Radic Biol Med | Authors: Yao Song | Species: mouse | Application: WB - Cold atmospheric plasma conveys selectivity on triple negative breast cancer cells both in vitro and in vivo.
Journal: Free Radic Biol Med | Authors: Liangjian Xiang | Species: human | Application: WB - LL37-induced mitochondrial stress activates the mtDNA/cGAS/STING pathway to promote mast cell-mediated rosacea inflammation.
Journal: Free Radic Biol Med | Authors: Rui Sun | Species: mouse,human | Application: WB - Bovine serum albumin-coated metal-phenolic nanoplatform for atherosclerosis therapy via targeted delivery and inhibition of vascular smooth muscle cells proliferation.
Journal: Free Radic Biol Med | Authors: Na Li | Species: rat | Application: WB - An integrated study of gut microbiota and serum metabolites in T2DM-ED rats after fecal microbiota transplantation.
Journal: Free Radic Biol Med | Authors: Cheng Cheng | Species: rat | Application: WB - Hepatocyte-derived Fetuin-A promotes alcohol-associated liver disease in mice by inhibiting autophagy-lysosome degradation of TLR and M2 macrophage polarization
Journal: Free Radic Biol Med | Authors: Shibang Lu | Species: mouse | Application: WB - Dietary supplementation of benzoic acid and essential oils combination enhances intestinal resilience against LPS stimulation in weaned piglets
Journal: J Anim Sci Biotechnol | Authors: Chang Cui | Species: pig | Application: WB - Chlorogenic acid alleviates IPEC-J2 pyroptosis induced by deoxynivalenol by inhibiting activation of the NF-κB/NLRP3/caspase-1 pathway
Journal: J Anim Sci Biotechnol | Authors: Yanmei Xue | Species: pig | Application: WB,IF - Sulforaphane prevents LPS-induced inflammation by regulating the Nrf2-mediated autophagy pathway in goat mammary epithelial cells and a mouse model of mastitis
Journal: J Anim Sci Biotechnol | Authors: Dan Shao | Species: goat | Application: WB,IF - Dietary Zn proteinate with moderate chelation strength alleviates heat stress-induced intestinal barrier function damage by promoting expression of tight junction proteins via the A20/NF-κB p65/MMP-2 pathway in the jejunum of broilers
Journal: J Anim Sci Biotechnol | Authors: Yangyang Hu | Species: chicken | Application: WB - Epigallocatechin-3-gallate protects bovine ruminal epithelial cells against lipopolysaccharide-induced inflammatory damage by activating autophagy
Journal: J Anim Sci Biotechnol | Authors: Wanli Zhao | Species: bovine | Application: WB - A synergistic nanozyme platform breaking the neuroinflammatory-oxidative stress cycle for extended pain relief.
Journal: Int J Pharm X | Authors: Chengfeng Zhang | Species: mouse | Application: WB - Dietary Zn proteinate with moderate chelation strength alleviates heat stress-induced intestinal barrier function damage by promoting expression of tight junction proteins via the A20/NF-κB p65/MMP-2 pathway in the jejunum of broilers
Journal: J Anim Sci Biotechnol | Authors: Yangyang Hu | Species: chicken | Application: WB - Restored intestinal integrity, nutrients transporters, energy metabolism, antioxidative capacity and decreased harmful microbiota were associated with IUGR piglet's catch-up growth before weanling
Journal: J Anim Sci Biotechnol | Authors: Chang Cui | Species: pig | Application: WB - Epigallocatechin-3-gallate protects bovine ruminal epithelial cells against lipopolysaccharide-induced inflammatory damage by activating autophagy
Journal: J Anim Sci Biotechnol | Authors: Wanli Zhao | Species: bovine | Application: WB - Ubc9-mediated SUMOylation of Ninj1 alleviates inflammatory responses in hepatic ischaemia/reperfusion injury.
Journal: Clin Transl Med | Authors: Kang Huang | Species: mouse | Application: WB - Hesperidin-β-Cyclodextrin inclusion complexes: A novel approach for preventing and treating acute lung injury caused by seawater drowning.
Journal: Int J Pharm X | Authors: Jingjing Hou | Species: mouse | Application: IHC - Dietary supplementation of benzoic acid and essential oils combination enhances intestinal resilience against LPS stimulation in weaned piglets
Journal: J Anim Sci Biotechnol | Authors: Chang Cui | Species: pig | Application: WB - Pterostilbene attenuates intrauterine growth retardation-induced colon inflammation in piglets by modulating endoplasmic reticulum stress and autophagy
Journal: J Anim Sci Biotechnol | Authors: Yanan Chen | Species: pig,human | Application: WB - Restored intestinal integrity, nutrients transporters, energy metabolism, antioxidative capacity and decreased harmful microbiota were associated with IUGR piglet's catch-up growth before weanling
Journal: J Anim Sci Biotechnol | Authors: Chang Cui | Species: pig | Application: WB - ROS-Responsive Prodrug Containing Dihydroartemisinin and Cinnamaldehyde for the Potential Treatment of Nonalcoholic Steatohepatitis.
Journal: ACS Appl Mater Interfaces | Authors: Ru Hao | Species: mouse | Application: WB,IF - Construction of an Infection-Inflammation Microenvironment-Regulating Nano-antimicrobial Agent and Application in the Treatment of Burn Wounds Complicated with Multidrug-Resistant Staphylococcus aureus Infection.
Journal: ACS Appl Mater Interfaces | Authors: Huifeng Qian - Cerium-Organic Framework and Resveratrol Composite Hydrogel Scaffold with Dual Antioxidant Activity for Enhanced Bone Regeneration
Journal: ACS Appl Mater Interfaces | Authors: Yao Lu | Species: rat | Application: WB - FGF21-engineered ADSCs promote diabetic wound healing by mitigating ferroptosis and oxidative stress via the SIRT1/NRF2/GPX4 signaling pathway.
Journal: Stem Cell Res Ther | Authors: Zhen Liang | Species: mouse | Application: IF - Construction of an Infection-Inflammation Microenvironment-Regulating Nano-antimicrobial Agent and Application in the Treatment of Burn Wounds Complicated with Multidrug-Resistant Staphylococcus aureus Infection.
Journal: ACS Appl Mater Interfaces | Authors: Huifeng Qian - A Visible-Light Photocatalysis/Hydrolysis Hydrogen-Generating Nanoplatform for Dynamic Inflammation Management via Immune Metabolism Orchestration during Wound Repair
Journal: ACS Appl Mater Interfaces | Authors: Zhaoyu Xu | Species: mouse | Application: WB - Thermal Ablation Therapy Integrated with Microenvironment Regulation and Anti-Inflammatory Effects for Choroidal Neovascularization.
Journal: ACS Appl Mater Interfaces | Authors: Jiayi Wei - Exosomal SNHG16 secreted by CSCs promotes glioma development via TLR7.
Journal: Stem Cell Res Ther | Authors: Ruijie Zhang | Species: human | Application: WB - FGF21-engineered ADSCs promote diabetic wound healing by mitigating ferroptosis and oxidative stress via the SIRT1/NRF2/GPX4 signaling pathway.
Journal: Stem Cell Res Ther | Authors: Zhen Liang | Species: mouse | Application: IF - ROS-Responsive Prodrug Containing Dihydroartemisinin and Cinnamaldehyde for the Potential Treatment of Nonalcoholic Steatohepatitis.
Journal: ACS Appl Mater Interfaces | Authors: Ru Hao | Species: mouse | Application: WB,IF - Lipophagy-ICAM-1 pathway associated with fatty acid and oxygen deficiencies is involved in poor prognoses of ovarian clear cell carcinoma
Journal: Br J Cancer | Authors: Shiro Koizume | Species: human | Application: WB - ROS-Responsive Prodrug Containing Dihydroartemisinin and Cinnamaldehyde for the Potential Treatment of Nonalcoholic Steatohepatitis.
Journal: ACS Appl Mater Interfaces | Authors: Ru Hao | Species: mouse | Application: WB,IF - Koumine Alleviates Lipopolysaccharide-Induced Intestinal Barrier Dysfunction in IPEC-J2 Cells by Regulating Nrf2/NF- κ B Pathway.
Journal: Am J Chin Med | Authors: Jing Wu | Species: pig | Application: WB,IF - Thermal Ablation Therapy Integrated with Microenvironment Regulation and Anti-Inflammatory Effects for Choroidal Neovascularization.
Journal: ACS Appl Mater Interfaces | Authors: Jiayi Wei - HuR promotes triglyceride synthesis and intestinal fat absorption
Journal: Cell Rep | Authors: Cihang Liu | Species: mouse | Application: WB - Bicuculline ameliorates metabolic dysfunction-associated steatotic liver disease by inhibiting the nuclear factor-kappa B pathway and reducing lipid accumulation
Journal: World J Gastroenterol | Authors: Xiao-Mei Wang | Species: mouse | Application: WB,IHC,IF - GABA regulates IL-1β production in macrophages
Journal: Cell Rep | Authors: Jian Fu | Species: mouse | Application: WB,IF - HuR promotes triglyceride synthesis and intestinal fat absorption
Journal: Cell Rep | Authors: Cihang Liu | Species: mouse | Application: WB - Milk extracellular vesicles attenuate pre-inflammatory bowel disease via Lctobacillus murinus-mediated TLR2 signaling modulation.
Journal: Cell Rep | Authors: Jiarun Xu | Species: mouse | Application: WB - YTHDF1 phase separation triggers the fate transition of spermatogonial stem cells by activating the IκB-NF-κB-CCND1 axis
Journal: Cell Rep | Authors: Qian Fang | Species: human | Application: WB,IF - MCT4-mediated lactate efflux promotes STING-dependent dendritic cell antitumor immunity.
Journal: Cell Rep | Authors: Rui Ding - The Scap-SREBP1-S1P/S2P lipogenesis signal orchestrates the homeostasis and spatiotemporal activation of NF-κB
Journal: Cell Rep | Authors: Xia Fei | Species: human | Application: WB - Bicuculline ameliorates metabolic dysfunction-associated steatotic liver disease by inhibiting the nuclear factor-kappa B pathway and reducing lipid accumulation
Journal: World J Gastroenterol | Authors: Xiao-Mei Wang | Species: mouse | Application: WB,IHC,IF - Nucleoporin93 limits Yap activity to prevent endothelial cell senescence
Journal: Aging Cell | Authors: Tung D Nguyen | Species: human | Application: WB - Pin1 promotes pancreatic cancer progression and metastasis by activation of NF-κB-IL-18 feedback loop.
Journal: Cell Prolif | Authors: Qiqing Sun | Species: human | Application: WB,IF - HMGB1-mediated differential response on hippocampal neurotransmitter disorder and neuroinflammation in adolescent male and female mice following cold exposure.
Journal: Brain Behav Immun | Authors: Bin Xu | Species: mouse | Application: WB - Isoflavones isolated from chickpea sprouts alleviate ovariectomy-induced osteoporosis in rats by dual regulation of bone remodeling
Journal: Biomed Pharmacother | Authors: Jinyong Huang | Species: rat | Application: WB - Chronic ethanol exposure induces hippocampal neuroinflammation and neuronal damage via the astrocytic RUNX1/TOLLIP/TLR3 pathway
Journal: Brain Behav Immun | Authors: Hui Shen - The JAK/STAT/NF-κB signaling pathway can be regulated by rosemary essential oil, thereby providing a potential treatment for DNCB-induced in mice
Journal: Biomed Pharmacother | Authors: Jinkai Li | Application: WB - Chronic ethanol exposure induces hippocampal neuroinflammation and neuronal damage via the astrocytic RUNX1/TOLLIP/TLR3 pathway
Journal: Brain Behav Immun | Authors: Hui Shen - Total alkaloids from Thesium chinense inhibit lipopolysaccharide-induced respiratory inflammation by modulating Nrf2/NF-κB/NLRP3 signaling pathway
Journal: Chin J Nat Med | Authors: Guohui Li | Species: mouse | Application: WB - Icariin attenuates vascular endothelial dysfunction by inhibiting inflammation through GPER/Sirt1/HMGB1 signaling pathway in type 1 diabetic rats
Journal: Chin J Nat Med | Authors: Wenhui Yao | Species: human | Application: WB - E3 ubiquitin ligase Pellino1 suppresses acinar cell necroptosis and alleviates severe acute pancreatitis by promoting ubiquitin-dependent receptor-interacting protein kinase 3 (RIP3) degradation
Journal: Br J Pharmacol | Authors: Jiatong Chen | Application: WB - Sleep Deprivation Exacerbates High-Fat Diet-Induced Obesity and MAFLD Through Melatonin Reduction Mediated NF-κB Activation.
Journal: J Pineal Res | Authors: Renjiao Liu | Species: zebrafish | Application: WB,IF - Chronic ethanol exposure induces hippocampal neuroinflammation and neuronal damage via the astrocytic RUNX1/TOLLIP/TLR3 pathway
Journal: Brain Behav Immun | Authors: Hui Shen - Schisantherin A attenuates ischemia/reperfusion-induced neuronal injury in rats via regulation of TLR4 and C5aR1 signaling pathways.
Journal: Brain Behav Immun | Authors: Yun Wei Shi | Species: rat | Application: WB - The JAK/STAT/NF-κB signaling pathway can be regulated by rosemary essential oil, thereby providing a potential treatment for DNCB-induced in mice
Journal: Biomed Pharmacother | Authors: Jinkai Li | Application: WB - Isoflavones isolated from chickpea sprouts alleviate ovariectomy-induced osteoporosis in rats by dual regulation of bone remodeling
Journal: Biomed Pharmacother | Authors: Jinyong Huang | Species: rat | Application: WB - Ginsenoside Rg5 promotes wound healing in diabetes by reducing the negative regulation of SLC7A11 on the efferocytosis of dendritic cells
Journal: J Ginseng Res | Authors: Wei Xia | Application: WB - First report of chalcones in Corema album berries: Multi-target suppression of macrophage inflammation through COX-2 inhibition and NF-κB modulation.
Journal: Biomed Pharmacother | Authors: Antonio Canoyra - Chronic ethanol exposure induces hippocampal neuroinflammation and neuronal damage via the astrocytic RUNX1/TOLLIP/TLR3 pathway
Journal: Brain Behav Immun | Authors: Hui Shen - Cyasterone inhibits IL-1β-mediated apoptosis and inflammation via the NF-κB and MAPK signaling pathways in rat chondrocytes and ameliorates osteoarthritisin vivo
Journal: Chin J Nat Med | Authors: Li Teng | Species: rat | Application: WB,IF - Bilirubin alleviates alum-induced peritonitis through inactivation of NLRP3 inflammasome.
Journal: Biomed Pharmacother | Authors: Yanke Lin | Species: mouse | Application: WB - Long non-coding RNA FTH1P3 regulated metastasis and invasion of esophageal squamous cell carcinoma through SP1/NF-kB pathway.
Journal: Biomed Pharmacother | Authors: Lijun Yang | Species: human | Application: WB - Therapeutic potential of naturally derived carbon dots in sepsis-associated acute kidney injury
Journal: Chin Med | Authors: Lei Wang | Species: mouse | Application: WB - Effects and mechanisms of Zhizi Chuanxiong herb pair against atherosclerosis: an integration of network pharmacology, molecular docking, and experimental validation
Journal: Chin Med | Authors: Yan Zhang | Species: mouse | Application: WB - Therapeutic potential of naturally derived carbon dots in sepsis-associated acute kidney injury
Journal: Chin Med | Authors: Lei Wang | Species: mouse | Application: WB - Early Minocycline and Late FK506 Treatment Improves Survival and Alleviates Neuroinflammation, Neurodegeneration, and Behavioral Deficits in Prion-Infected Hamsters.
Journal: Neurotherapeutics | Authors: Syed Zahid Ali Shah | Species: hamster | Application: WB - Exploring the role of RCEO in macrophage-mediated modulation of pulmonary fibrosis.
Journal: Chin Med | Authors: Zhiguo Mao | Species: mouse | Application: WB - Juanbi Qianggu Formula inhibits fibroblast-like synovicytes activation via repressing LncRNA ITSN1-2 to promote RIP2 K48 ubiquitination
Journal: Chin Med | Authors: Yanqin Bian | Species: human | Application: WB - Annexin-1 Mimetic Peptide Ac2-26 Suppresses Inflammatory Mediators in LPS-Induced Astrocytes and Ameliorates Pain Hypersensitivity in a Rat Model of Inflammatory Pain.
Journal: Cell Mol Neurobiol | Authors: Zhenzhao Luo | Species: rat | Application: WB - Nrf2 mediates the effects of shionone on silica-induced pulmonary fibrosis
Journal: Chin Med | Authors: Guiyun Wang | Species: mouse | Application: IF - Annexin-1 Mimetic Peptide Ac2-26 Suppresses Inflammatory Mediators in LPS-Induced Astrocytes and Ameliorates Pain Hypersensitivity in a Rat Model of Inflammatory Pain.
Journal: Cell Mol Neurobiol | Authors: Zhenzhao Luo | Species: rat | Application: WB - Ershen Dan attenuates atherosclerosis by modulating the NOTCH1/NF-κB/NLRP3 signaling pathway to suppress M1 macrophage polarization.
Journal: Chin Med | Authors: Wenjie Zhao | Species: mouse | Application: WB - Therapeutic potential of naturally derived carbon dots in sepsis-associated acute kidney injury
Journal: Chin Med | Authors: Lei Wang | Species: mouse | Application: WB - Early Minocycline and Late FK506 Treatment Improves Survival and Alleviates Neuroinflammation, Neurodegeneration, and Behavioral Deficits in Prion-Infected Hamsters.
Journal: Neurotherapeutics | Authors: Syed Zahid Ali Shah | Species: hamster | Application: WB - Salidroside ameliorates experimental autoimmune neuritis by dually modulating neuroinflammation and immune homeostasis via PI3K/AKT signaling.
Journal: Neurotherapeutics | Authors: Tao Gu | Species: rat | Application: WB - Yiqi Wenyang Formula ameliorates diabetic kidney disease via inhibiting inflammation and regulating the gut microbiota-bile acid axis in mice by FXR signaling pathway.
Journal: Chin Med | Authors: Tongyi Yuan | Species: mouse | Application: WB - Protective Effects of Cinnamaldehyde against Mesenteric Ischemia-Reperfusion-Induced Lung and Liver Injuries in Rats.
Journal: Oxid Med Cell Longev | Authors: Marwan Almoiliqy | Species: rat | Application: WB,IF - Dl-3-n-Butylphthalide Improves Neuroinflammation in Mice with Repeated Cerebral Ischemia-Reperfusion Injury through the Nrf2-Mediated Antioxidant Response and TLR4/MyD88/NF-κB Signaling Pathway.
Journal: Oxid Med Cell Longev | Authors: Yaran Gao | Species: rat,mouse | Application: WB - Aloin Preconditioning Attenuates Hepatic Ischemia/Reperfusion Injury via Inhibiting TLR4/MyD88/NF-κB Signal Pathway In Vivo and In Vitro.
Journal: Oxid Med Cell Longev | Authors: Yichao Du | Species: mouse | Application: WB - MicroRNA-145 Protects against Myocardial Ischemia Reperfusion Injury via CaMKII-Mediated Antiapoptotic and Anti-Inflammatory Pathways.
Journal: Oxid Med Cell Longev | Authors: Zhebo Liu | Species: rat | Application: IF - Exploring the Oxidative Stress Mechanism of Buyang Huanwu Decoction in Intervention of Vascular Dementia Based on Systems Biology Strategy.
Journal: Oxid Med Cell Longev | Authors: Kailin Yang | Species: rat | Application: WB,IHC - Salidroside stimulates mitochondrial biogenesis and protects against H₂O₂-induced endothelial dysfunction.
Journal: Oxid Med Cell Longev | Authors: Shasha Xing - Dl-3-n-Butylphthalide Improves Neuroinflammation in Mice with Repeated Cerebral Ischemia-Reperfusion Injury through the Nrf2-Mediated Antioxidant Response and TLR4/MyD88/NF-κB Signaling Pathway.
Journal: Oxid Med Cell Longev | Authors: Yaran Gao | Species: rat,mouse | Application: WB - l-Theanine Ameliorates d-Galactose-Induced Brain Damage in Rats via Inhibiting AGE Formation and Regulating Sirtuin1 and BDNF Signaling Pathways.
Journal: Oxid Med Cell Longev | Authors: Li Zeng | Species: Rat - Effects of Saccharides from Arctium lappa L. Root on FeCl3-Induced Arterial Thrombosis via the ERK/NF-κB Signaling Pathway
Journal: Oxid Med Cell Longev | Authors: Tiantian Qiu | Species: human | Application: WB - The Evaluation of the Antioxidant and Intestinal Protective Effects of Baicalin-Copper in Deoxynivalenol-Challenged Piglets.
Journal: Oxid Med Cell Longev | Authors: Andong Zha | Species: pig | Application: WB - Protective Effects of Cinnamaldehyde against Mesenteric Ischemia-Reperfusion-Induced Lung and Liver Injuries in Rats.
Journal: Oxid Med Cell Longev | Authors: Marwan Almoiliqy | Species: rat | Application: WB,IF - MicroRNA-145 Protects against Myocardial Ischemia Reperfusion Injury via CaMKII-Mediated Antiapoptotic and Anti-Inflammatory Pathways.
Journal: Oxid Med Cell Longev | Authors: Zhebo Liu | Species: rat | Application: IF - l-Theanine Ameliorates d-Galactose-Induced Brain Damage in Rats via Inhibiting AGE Formation and Regulating Sirtuin1 and BDNF Signaling Pathways.
Journal: Oxid Med Cell Longev | Authors: Li Zeng | Species: Rat - Cardioprotective and anti-inflammatory effects of Caveolin 1 in experimental diabetic cardiomyopathy
Journal: Clin Sci (Lond) | Authors: Wenyan Gong | Species: rat,mouse | Application: WB,IHC - Iridium(III)-Based PD-L1 Agonist Regulates p62 and ATF3 for Enhanced Cancer Immunotherapy
Journal: J Med Chem | Authors: Dongping Deng | Species: human | Application: WB - MELK predicts poor prognosis and promotes metastasis in esophageal squamous cell carcinoma via activating the NF‑κB pathway.
Journal: Int J Oncol | Authors: Jiecheng Ye | Species: human | Application: WB - Hijacking the Hydrogen Sulfide Axis: A Novel 4-Trifluoromethylquinoline Derivative Suppresses Glioblastoma via Cystathionine γ-Lyase Suppression.
Journal: J Med Chem | Authors: Zhiqiong Luo | Species: human | Application: WB - miRNA-99b-3p functions as a potential tumor suppressor by targeting glycogen synthase kinase-3β in oral squamous cell carcinoma Tca-8113 cells.
Journal: Int J Oncol | Authors: Kang He | Species: human | Application: WB - Iridium(III)-Based PD-L1 Agonist Regulates p62 and ATF3 for Enhanced Cancer Immunotherapy
Journal: J Med Chem | Authors: Dongping Deng | Species: human | Application: WB - Hijacking the Hydrogen Sulfide Axis: A Novel 4-Trifluoromethylquinoline Derivative Suppresses Glioblastoma via Cystathionine γ-Lyase Suppression.
Journal: J Med Chem | Authors: Zhiqiong Luo | Species: human | Application: WB - Mechanistic study of acupuncture on the pterygopalatine ganglion to improve allergic rhinitis: analysis of multi-target effects based on bioinformatics/network topology strategie
Journal: Brief Bioinform | Authors: Meihui Tian | Species: rat | Application: WB - Overexpression of SERPINA3 suppresses tumor progression by modulating SPOP/NF‑κB in lung cancer
Journal: Int J Oncol | Authors: Yanxia Jin | Species: human | Application: WB - Gemfibrozil-Platinum(IV) Precursors for New Enhanced-Starvation and Chemotherapy In Vitro and In Vivo
Journal: J Med Chem | Authors: Xue-Qing Song | Species: human | Application: IF - Discovery of a Hidden Pocket beneath the NES Groove by Novel Noncovalent CRM1 Inhibitors
Journal: J Med Chem | Authors: Cong Li - The hepatitis B virus X protein downregulates NF-κB signaling pathways through decreasing the Notch signaling pathway in HBx-transformed L02 cells.
Journal: Int J Oncol | Authors: Luo Jing J | Species: human | Application: WB - Cardioprotective and anti-inflammatory effects of Caveolin 1 in experimental diabetic cardiomyopathy
Journal: Clin Sci (Lond) | Authors: Wenyan Gong | Species: rat,mouse | Application: WB,IHC - ADAM12 silencing promotes cellular apoptosis by activating autophagy in choriocarcinoma cells.
Journal: Int J Oncol | Authors: Lin Wang | Species: human | Application: WB - Chronic exposure to polystyrene microplastics induced LHR reduction and decreased testosterone levels through NF-κB pathway
Journal: Environ Pollut | Authors: Haibo Jin | Species: mouse | Application: WB - Fluoride-induced osteoporosis via interfering with the RANKL/RANK/OPG pathway in ovariectomized rats: Oophorectomy shifted skeletal fluorosis from osteosclerosis to osteoporosis
Journal: Environ Pollut | Authors: Ye Jin | Species: rat | Application: IHC,IF - Disrupting the gut microbiota/metabolites axis by Di-(2-ethylhexyl) phthalate drives intestinal inflammation via AhR/NF-κB pathway in mice
Journal: Environ Pollut | Authors: Xinyi Cheng | Species: mouse | Application: WB - DBDPE upregulates NOD-like receptor signaling to induce NLRP3 inflammasome-mediated HAECs pyroptosis
Journal: Environ Pollut | Authors: Li Jing | Species: human | Application: WB - Disrupting the gut microbiota/metabolites axis by Di-(2-ethylhexyl) phthalate drives intestinal inflammation via AhR/NF-κB pathway in mice
Journal: Environ Pollut | Authors: Xinyi Cheng | Species: mouse | Application: WB - Serum amyloid A and interleukin -1β facilitate LDL transcytosis across endothelial cells and atherosclerosis via NF-κB/caveolin-1/cavin-1 pathway
Journal: Atherosclerosis | Authors: Xiong Jia - Ganoderic acids alleviate atherosclerosis by inhibiting macrophage M1 polarization via TLR4/MyD88/NF-κB signaling pathway
Journal: Atherosclerosis | Authors: Ya-Zhu Quan | Species: mouse | Application: WB - Curdione combined with borneol treats bacterial mixed HPV infection by regulating the crosstalk among immune cells
Journal: Front Immunol | Authors: Jingwei Liu | Species: mouse | Application: WB,IF - Secretory leukocyte protease inhibitor suppresses HPV E6-expressing HNSCC progression by mediating NF-κB and Akt pathways.
Journal: Cancer Cell Int | Authors: Yu Jin | Species: human | Application: WB - Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models.
Journal: J Invest Dermatol | Authors: Jing Wang | Species: mouse | Application: IHC - Herpes Simplex Virus 1 UL2 Inhibits the TNF-α-Mediated NF-κB Activity by Interacting With p65/p50.
Journal: Front Immunol | Authors: Mingsheng Cai | Species: human | Application: WB,IP - Secretory leukocyte protease inhibitor suppresses HPV E6-expressing HNSCC progression by mediating NF-κB and Akt pathways.
Journal: Cancer Cell Int | Authors: Yu Jin | Species: human | Application: WB - A CDK4/6 inhibitor-armed oncolytic adenovirus reverses T cell exhaustion through the Rb-p65-CCL5 pathway and potentiates the antitumor activity of anti-PD-1 or CAR-T therapy in colorectal cancer.
Journal: Front Immunol | Authors: Dan Zhou - Aspartate Metabolism Facilitates IL-1β Production in Inflammatory Macrophages.
Journal: Front Immunol | Authors: Hao Wang | Species: mouse | Application: WB - Swine acute diarrhoea syndrome coronavirus (SADS-CoV) Nsp5 antagonizes type I interferon signaling by cleaving DCP1A
Journal: Front Immunol | Authors: Hai-Xin Huang | Species: human | Application: WB - Herpes simplex virus type 2 inhibits TNF-α-induced NF-κB activation through viral protein ICP22-mediated interaction with p65
Journal: Front Immunol | Authors: Huimin Hu | Species: human | Application: WB,IF,CoIP - Swine acute diarrhoea syndrome coronavirus (SADS-CoV) Nsp5 antagonizes type I interferon signaling by cleaving DCP1A
Journal: Front Immunol | Authors: Hai-Xin Huang | Species: human | Application: WB - Endothelial exosomes work as a functional mediator to activate macrophages
Journal: Front Immunol | Authors: Wenwen Lin | Species: human | Application: WB - Single-Cell Transcriptome Analysis of Chronic Antibody-Mediated Rejection After Renal Transplantation.
Journal: Front Immunol | Authors: Fanhua Kong | Species: human | Application: WB - Secretory leukocyte protease inhibitor suppresses HPV E6-expressing HNSCC progression by mediating NF-κB and Akt pathways.
Journal: Cancer Cell Int | Authors: Yu Jin | Species: human | Application: WB - Quercetin Preserves Oral Cavity Health by Mitigating Inflammation and Microbial Dysbiosis.
Journal: Front Immunol | Authors: Erin C Mooney | Species: human | Application: IF - Magnolol Alleviates Inflammatory Responses and Lipid Accumulation by AMP-Activated Protein Kinase-Dependent Peroxisome Proliferator-Activated Receptor α Activation.
Journal: Front Immunol | Authors: Ye Tian | Species: human | Application: WB - Serine Supports IL-1β Production in Macrophages Through mTOR Signaling.
Journal: Front Immunol | Authors: Siyuan Chen | Species: mouse | Application: WB - EIF4A3-induced circPRKAR1B promotes esophageal squamous cell carcinoma progression through binding PKM2 to regulate NF-κB induced CCL3 secretion
Journal: Cancer Cell Int | Authors: Shiji Li | Species: human | Application: WB,IHC - Secretory leukocyte protease inhibitor suppresses HPV E6-expressing HNSCC progression by mediating NF-κB and Akt pathways.
Journal: Cancer Cell Int | Authors: Yu Jin | Species: human | Application: WB - NETs drive myocardial fibrosis in hypertension via an NF-κB/ferroptosis axis.
Journal: Front Immunol | Authors: Qingxian Tu | Species: rat | Application: WB - Quercetin Preserves Oral Cavity Health by Mitigating Inflammation and Microbial Dysbiosis.
Journal: Front Immunol | Authors: Erin C Mooney | Species: human | Application: IF - A CDK4/6 inhibitor-armed oncolytic adenovirus reverses T cell exhaustion through the Rb-p65-CCL5 pathway and potentiates the antitumor activity of anti-PD-1 or CAR-T therapy in colorectal cancer.
Journal: Front Immunol | Authors: Dan Zhou - Mycoplasma genitalium Protein of Adhesion Induces Inflammatory Cytokines via Cyclophilin A-CD147 Activating the ERK-NF-κB Pathway in Human Urothelial Cells.
Journal: Front Immunol | Authors: Lingling Li | Species: human | Application: WB - Herpes Simplex Virus 1 UL2 Inhibits the TNF-α-Mediated NF-κB Activity by Interacting With p65/p50.
Journal: Front Immunol | Authors: Mingsheng Cai | Species: human | Application: WB,IP - Hepatitis B Surface Antigen Suppresses the Activation of Nuclear Factor Kappa B Pathway via Interaction With the TAK1-TAB2 Complex.
Journal: Front Immunol | Authors: Feiyan Deng | Species: human | Application: WB - MSC-ACE2 Ameliorates Streptococcus uberis-Induced Inflammatory Injury in Mammary Epithelial Cells by Upregulating the IL-10/STAT3/SOCS3 Pathway.
Journal: Front Immunol | Authors: Shuping Yan | Species: rat | Application: WB - LncRNA NRIR inhibits osteogenesis by promoting macrophage M1 polarization through RSAD2/NF-κB axis in peri-implantitis.
Journal: Front Immunol | Authors: Renshengjie Zhao | Species: human | Application: WB - Mycoplasma genitalium Protein of Adhesion Induces Inflammatory Cytokines via Cyclophilin A-CD147 Activating the ERK-NF-κB Pathway in Human Urothelial Cells.
Journal: Front Immunol | Authors: Lingling Li | Species: human | Application: WB - EIF4A3-induced circPRKAR1B promotes esophageal squamous cell carcinoma progression through binding PKM2 to regulate NF-κB induced CCL3 secretion
Journal: Cancer Cell Int | Authors: Shiji Li | Species: human | Application: WB,IHC - Inhibitory Effects of the Lactobacillus rhamnosus GG Effector Protein HM0539 on Inflammatory Response Through the TLR4/MyD88/NF-кB Axis.
Journal: Front Immunol | Authors: Yubin Li | Species: mouse | Application: IHC - GRP78 Downregulation in Keratinocytes Promotes Skin Inflammation Via the Recruitment and Activation of CCR6+ IL-17A-producing γδ T Cells
Journal: J Invest Dermatol | Authors: Liang Zhao | Species: human | Application: WB - Material basis and molecular mechanisms of Chaihuang Qingyi Huoxue Granule in the treatment of acute pancreatitis based on network pharmacology and molecular docking-based strategy
Journal: Front Immunol | Authors: Jia Yang | Species: rat | Application: WB - Transcriptomic Profiling Reveals a Role for TREM-1 Activation in Enterovirus D68 Infection-Induced Proinflammatory Responses.
Journal: Front Immunol | Authors: Jinyu Li | Species: human | Application: WB,IF - Magnolol Alleviates Inflammatory Responses and Lipid Accumulation by AMP-Activated Protein Kinase-Dependent Peroxisome Proliferator-Activated Receptor α Activation.
Journal: Front Immunol | Authors: Ye Tian | Species: human | Application: WB - Inhibitory Effects of the Lactobacillus rhamnosus GG Effector Protein HM0539 on Inflammatory Response Through the TLR4/MyD88/NF-кB Axis.
Journal: Front Immunol | Authors: Yubin Li | Species: mouse | Application: IHC - Pharmacological induction of autophagy reduces inflammation in macrophages by degrading immunoproteasome subunits
Journal: PLoS Biol | Authors: Jiao Zhou | Species: mouse | Application: WB,IF - Antidepressant activity of ω-3 polyunsaturated fatty acids in ovariectomized rats: role of neuroinflammation and microglial polarization.
Journal: Lipids Health Dis | Authors: Bin Wu | Species: rat | Application: WB - Anti-lung cancer synergy of low-dose doxorubicin and PD-L1 blocker co-delivered via mild photothermia-responsive black phosphorus
Journal: Drug Deliv Transl Res | Authors: Hua-Zhen Xu | Species: mouse | Application: WB - Multi-Omics Analysis of the Immune Effect of the Engineered Exosome Drug Delivery System in Inducing Macrophage Apoptosis
Journal: Pharmaceutics | Authors: Wei Xiang | Species: mouse | Application: WB - Effective-components combination alleviates PM2.5-induced inflammation by evoking macrophage autophagy in COPD
Journal: J Ethnopharmacol | Authors: Jing Wang | Species: mouse | Application: WB - Wu-Mei-Wan ameliorates chronic colitis-associated intestinal fibrosis through inhibiting fibroblast activation.
Journal: J Ethnopharmacol | Authors: Fan Wu | Species: mouse | Application: WB - Cepharanthine relieves nonalcoholic steatohepatitis through inhibiting STAT1/CXCL10 axis-mediated lipogenesis and inflammatory responses
Journal: J Ethnopharmacol | Authors: Pan Li | Species: rat,human | Application: WB - 4D-DIA-based Proteomics Analysis Reveals the Protective Effects of Pidanjiangtang Granules in IGT Rat Model
Journal: J Ethnopharmacol | Authors: Yu Xie | Species: rat | Application: WB - Gingerenone A ameliorates airway inflammation and remodeling in asthma by modulating the TLR4/MyD88/NF-κB pathway.
Journal: J Ethnopharmacol | Authors: Yingjie Zhu | Species: mouse | Application: WB,IHC,IF - Annao Pingchong decoction alleviate the neurological impairment by attenuating neuroinflammation and apoptosis in intracerebral hemorrhage rats
Journal: J Ethnopharmacol | Authors: Chun Guo | Species: rat | Application: IF - Taxus chinensis (Pilg.) Rehder fruit attenuates aging behaviors and neuroinflammation by inhibiting microglia activation via TLR4/NF-κB/NLRP3 pathway
Journal: J Ethnopharmacol | Authors: Chen Meimei | Species: mouse | Application: WB - Investigating the possible mechanism of Cornus officinalis in the therapy of ischemic stroke by UHPLC-Q-TOF-MS, network pharmacology, molecular docking, and experimental verification
Journal: J Ethnopharmacol | Authors: Yan Zhang | Species: rat | Application: WB - Huaier suppresses cisplatin resistance in non-small cell lung cancer by inhibiting the JNK/JUN/IL-8 signaling pathway
Journal: J Ethnopharmacol | Authors: Haoyi Jin | Species: human | Application: WB - Atractylenolide III attenuates acute kidney injury through phosphorylation of PIK3CA: Functional activation and molecular interaction analysis.
Journal: J Ethnopharmacol | Authors: Jianmin You | Species: mouse,human | Application: WB - Wutou decoction ameliorates rheumatoid arthritis through inhibiting hypoxia-induced invasive phenotype of fibroblast-like synoviocytes mediated by the Notch pathway.
Journal: J Ethnopharmacol | Authors: Weiji Lin | Species: human | Application: WB - Huang-Lian-Jie-Du Decoction Alleviates Diabetic Encephalopathy by Regulating Inflammation and Pyroptosis via Suppression of AGEs/RAGE/NF-κB Pathways
Journal: J Ethnopharmacol | Authors: Guo-Dong Zhuang | Species: mouse | Application: WB,IF - Solidago decurrens Lour. controls LPS-induced acute lung injury by reducing inflammatory responses and modulating the TLR4/NF-κB/NLRP3 signaling pathway
Journal: J Ethnopharmacol | Authors: Dan-Yang Ma | Species: mouse | Application: WB - From multi-omics discovery to experimental validation: GPC4 mediates the anti-neuroinflammatory effects of Buyang Huanwu decoction via TLR4/NF-κB signaling in ischemic stroke with Qi deficiency and blood stasis syndrome.
Journal: J Ethnopharmacol | Authors: Chenxing Zhang | Species: rat | Application: WB,IF - Platycodon grandiflorum: A promising medicinal and food homologous plant for cigarette smoke-induced chronic bronchitis
Journal: J Ethnopharmacol | Authors: Jianwen Sun | Application: WB - Guyuan Jiannao Decoction improves neurovascular unit dysfunction by regulating PI3K/AKT/NF-κB signaling pathway in cerebral small vessel disease rats
Journal: J Ethnopharmacol | Authors: Ziyan Zhong | Species: rat | Application: WB - Proteomic analysis reveals that Acalypha australis L. mitigates chronic colitis by modulating the FABP4/PPARγ/NF-κB signaling pathway
Journal: J Ethnopharmacol | Authors: Xiaoyu Quan | Species: mouse | Application: WB - Annao Pingchong decoction alleviate the neurological impairment by attenuating neuroinflammation and apoptosis in intracerebral hemorrhage rats
Journal: J Ethnopharmacol | Authors: Chun Guo | Species: rat | Application: IF - Cyberpharmacology uncover the mechanism of the total Rhizoma Coptidis extracts ameliorate chronic atrophic gastritis
Journal: J Ethnopharmacol | Authors: Zhengcai Ma | Species: mouse | Application: WB - Shuxuetong Injection inhibits pyroptosis in acute ischemic stroke via CD44/NLRP3/GSDMD signal
Journal: J Ethnopharmacol | Authors: Jinfeng Shang | Species: rat | Application: WB - Mechanism exploration of ancient pharmaceutic processing (Paozhi) improving the gastroprotective efficacy of Aucklandiae Radix.
Journal: J Ethnopharmacol | Authors: Shen Song | Species: rat | Application: WB - Daqing formula ameliorated allergic asthma and airway dysbacteriosis in mice challenged with ovalbumin and ampicillin
Journal: J Ethnopharmacol | Authors: Li-Ren Wu | Species: mouse,human | Application: WB - Wumei Wan ameliorates ulcerative colitis in rats by modulating the inflammation-pyroptosis-intestinal stem cell axis.
Journal: J Ethnopharmacol | Authors: Yao Zhang | Species: rat | Application: WB - Research on the compatibility mechanism of the Tingli Dazao Xiefei Decoction by multi-organ metabolomics strategy.
Journal: J Ethnopharmacol | Authors: Rui-Feng Wang | Species: rat | Application: WB - Yang-Xin-Shu-Mai granule alleviates atherosclerosis by regulating macrophage polarization via the TLR9/MyD88/NF-κB signaling pathway
Journal: J Ethnopharmacol | Authors: Hong Huang | Species: mouse | Application: WB,IF - Huashi Baidu granules alleviates LPS-induced acute lung injury by targeting TACE-mediated inflammatory signaling and stress granules disassembly
Journal: J Ethnopharmacol | Authors: Yuman Ma | Application: WB - Huang-Lian-Jie-Du Decoction Alleviates Diabetic Encephalopathy by Regulating Inflammation and Pyroptosis via Suppression of AGEs/RAGE/NF-κB Pathways
Journal: J Ethnopharmacol | Authors: Guo-Dong Zhuang | Species: mouse | Application: WB,IF - The protective role of Cordyceps cicadae and its active ingredient Myriocin against sodium iodate-induced age-related macular degeneration via an anti-necroptotic TNF-RIPK1/3 pathway
Journal: J Ethnopharmacol | Authors: Shao-Zhuang Ma | Species: human | Application: WB - Renoprotective activity of Ribes diacanthum pall (RDP) against inflammation in cisplatin-stimulated mice model and human renal tubular epithelial cells.
Journal: J Ethnopharmacol | Authors: Yanliang Wu | Species: human | Application: WB - Simiao San alleviates hyperuricemia and kidney inflammation by inhibiting NLRP3 inflammasome and JAK2/STAT3 signaling in hyperuricemia mice
Journal: J Ethnopharmacol | Authors: Yueyi Zhang | Species: mouse | Application: WB - Jiawei Ermiao Granules (JWEMGs) clear persistent HR-HPV infection though improving vaginal microecology
Journal: J Ethnopharmacol | Authors: Xiu Li | Species: human | Application: WB - Wutou decoction ameliorates rheumatoid arthritis through inhibiting hypoxia-induced invasive phenotype of fibroblast-like synoviocytes mediated by the Notch pathway.
Journal: J Ethnopharmacol | Authors: Weiji Lin | Species: human | Application: WB - Euphorbia humifusa Willd. extract alleviates imiquimod-induced psoriasis-like skin lesions in mice by modulating the IL-17 signaling pathway
Journal: J Ethnopharmacol | Authors: Abudureyimu Alimujiang | Species: mouse | Application: WB - Dahuang Zhechong pill attenuates hepatic sinusoidal capillarization in liver cirrhosis and hepatocellular carcinoma rat model via MK/integrin signaling pathway
Journal: J Ethnopharmacol | Authors: Chuankui Fu | Species: rat | Application: WB - Protective role of alkaloids of Calanthe fimbriata against ethanol-induced gastric ulcer in mice: Involvement of anti-gastric acid secretion and suppression of NF-κB/MAPK inflammatory cascades.
Journal: J Ethnopharmacol | Authors: Chunping Yu - Renoprotective activity of Ribes diacanthum pall (RDP) against inflammation in cisplatin-stimulated mice model and human renal tubular epithelial cells.
Journal: J Ethnopharmacol | Authors: Yanliang Wu | Species: human | Application: WB - Cyberpharmacology uncover the mechanism of the total Rhizoma Coptidis extracts ameliorate chronic atrophic gastritis
Journal: J Ethnopharmacol | Authors: Zhengcai Ma | Species: mouse | Application: WB - Renoprotective activity of Ribes diacanthum pall (RDP) against inflammation in cisplatin-stimulated mice model and human renal tubular epithelial cells.
Journal: J Ethnopharmacol | Authors: Yanliang Wu | Species: human | Application: WB - Huatanhuoxue Decoction alleviates airway inflammation by regulating IL-17A signaling pathway in obese asthmatic mice
Journal: J Ethnopharmacol | Authors: Yun Sun | Application: WB - Classical prescription Daqinjiao decoction inhibit cerebral ischemia/reperfusion induced necroptosis and ferroptosis through multiple mechanisms
Journal: J Ethnopharmacol | Authors: Yuwen Liu | Application: WB - Platycodon grandiflorum: A promising medicinal and food homologous plant for cigarette smoke-induced chronic bronchitis
Journal: J Ethnopharmacol | Authors: Jianwen Sun | Application: WB - Ophiocordyceps lanpingensis polysaccharides alleviate chronic kidney disease through MAPK/NF-κB pathway.
Journal: J Ethnopharmacol | Authors: Shubo Zhou | Species: mouse | Application: WB - Euphorbia humifusa Willd. extract alleviates imiquimod-induced psoriasis-like skin lesions in mice by modulating the IL-17 signaling pathway
Journal: J Ethnopharmacol | Authors: Abudureyimu Alimujiang | Species: mouse | Application: WB - Sub-chronic exposure to realgar induces liver injury via upregulating the TXNIP/NLRP3 pathway and disturbing bile acid homeostasis in mice
Journal: J Ethnopharmacol | Authors: Aihong Li | Species: mouse | Application: WB - Huang-Lian-Jie-Du Decoction Alleviates Diabetic Encephalopathy by Regulating Inflammation and Pyroptosis via Suppression of AGEs/RAGE/NF-κB Pathways
Journal: J Ethnopharmacol | Authors: Guo-Dong Zhuang | Species: mouse | Application: WB,IF - Protective effect and mechanism of Zhuang medicine Tinosporae Radix on LPS-induced neuroinflammation
Journal: J Ethnopharmacol | Authors: Jingjing Wang | Species: mouse | Application: WB - Protective role of alkaloids of Calanthe fimbriata against ethanol-induced gastric ulcer in mice: Involvement of anti-gastric acid secretion and suppression of NF-κB/MAPK inflammatory cascades.
Journal: J Ethnopharmacol | Authors: Chunping Yu - The ethanol extract of Scutellaria baicalensis Georgi attenuates complete Freund's adjuvant (CFA)-induced inflammatory pain by suppression of P2X3 receptor
Journal: J Ethnopharmacol | Authors: Li Gao | Species: rat | Application: WB - Effect of 1-Deoxynojirimycin on insulin resistance in prediabetic mice based on next-generation sequencing and intestinal microbiota study.
Journal: J Ethnopharmacol | Authors: Xinxiu Ren | Application: WB - Ganluyin ameliorates DSS-induced ulcerative colitis by inhibiting the enteric-origin LPS/TLR4/NF-κB pathway.
Journal: J Ethnopharmacol | Authors: Taoxiu Xiong | Application: WB - Decoding the healing secrets of Gegenqinlian decoction: A promising approach to radiation-induced intestinal injury
Journal: J Ethnopharmacol | Authors: Meng Zhang | Application: WB - Yang-Xin-Shu-Mai granule alleviates atherosclerosis by regulating macrophage polarization via the TLR9/MyD88/NF-κB signaling pathway
Journal: J Ethnopharmacol | Authors: Hong Huang | Species: mouse | Application: WB,IF - Systematic reevaluation on the antipyretic, analgesic effects, and uncover the mechanisms of Chaiqin Qingning capsule, a traditional Chinese medicine, via establishing lipopolysaccharide - induced fever models, physical and chemical - stimuli pain models
Journal: J Ethnopharmacol | Authors: Lianzhan Huang - Total Extract of Folium Rhododendri Daurici alleviate MASLD by regulating PPAR and TNF signaling pathways.
Journal: J Ethnopharmacol | Authors: Yanmin Zhang | Species: mouse,human | Application: WB - Fucoidan from Laminaria japonica protects renal tubular epithelial cells from uric acid induced NLRP3-mediated pyroptosis through inhibition of NF-κB pathway
Journal: J Ethnopharmacol | Authors: Xiaohui Tan | Species: human | Application: WB - Solidago decurrens Lour. controls LPS-induced acute lung injury by reducing inflammatory responses and modulating the TLR4/NF-κB/NLRP3 signaling pathway
Journal: J Ethnopharmacol | Authors: Dan-Yang Ma | Species: mouse | Application: WB - Nao-Xin-Tong Capsule alleviates astrocyte end-foot swelling after cerebral ischemia-reperfusion injury via NF-κB/MMP9/AQP4 signal and NF-κB/CXCL12/CXCR4 signal.
Journal: J Ethnopharmacol | Authors: Jinfeng Shang | Species: rat | Application: WB,IF - Decoding the healing secrets of Gegenqinlian decoction: A promising approach to radiation-induced intestinal injury
Journal: J Ethnopharmacol | Authors: Meng Zhang | Application: WB - The structural features and anti-inflammatory properties of a glucogalactan from Holotrichia diomphalia Bates (Qi Cao)
Journal: J Ethnopharmacol | Authors: Wen-Juan Liu | Species: mouse | Application: WB - Ethnopharmacological relevance and anti-inflammatory mechanisms of Lycopi Herba in diabetic nephropathy: Integrated chemical profiling and pharmacological evaluation.
Journal: J Ethnopharmacol | Authors: Lu-Zhou Chen | Species: mouse | Application: WB - Anti-inflammatory activity of the water extract of Chloranthus serratus roots in LPS-stimulated RAW264.7 cells mediated by the Nrf2/HO-1, MAPK and NF-κB signaling pathways.
Journal: J Ethnopharmacol | Authors: Shuping Sun | Species: mouse | Application: WB - Protective effect of the effective part of Andrographis paniculata (Burm.f.) Nees on PM2.5-induced lung injury in rats by modulating the NF-κB pathway.
Journal: J Ethnopharmacol | Authors: Hailu Yao | Application: WB - The structural features and anti-inflammatory properties of a glucogalactan from Holotrichia diomphalia Bates (Qi Cao)
Journal: J Ethnopharmacol | Authors: Wen-Juan Liu | Species: mouse | Application: WB - Protective Effects of the Ethyl Acetate Fraction from Madeng'ai on Lipopolysaccharide-Induced Acute Lung Injury in Mice: Insights from Integrated Multi-Omics Analysis.
Journal: J Ethnopharmacol | Authors: Ziyang Zhang | Species: mouse | Application: WB - Fucoidan from Laminaria japonica protects renal tubular epithelial cells from uric acid induced NLRP3-mediated pyroptosis through inhibition of NF-κB pathway
Journal: J Ethnopharmacol | Authors: Xiaohui Tan | Species: human | Application: WB - Salvia miltiorrhiza Bge. processed with porcine cardiac blood alleviates cerebral ischemia reperfusion injury through activating PPARγ/NF-κB pathway via suppressing arachidonic acid metabolism.
Journal: J Ethnopharmacol | Authors: Shikang Zhou | Species: rat | Application: WB - Salvia miltiorrhiza Bge. processed with porcine cardiac blood alleviates cerebral ischemia reperfusion injury through activating PPARγ/NF-κB pathway via suppressing arachidonic acid metabolism.
Journal: J Ethnopharmacol | Authors: Shikang Zhou | Species: rat | Application: WB - The ethanol extract of Scutellaria baicalensis Georgi attenuates complete Freund's adjuvant (CFA)-induced inflammatory pain by suppression of P2X3 receptor
Journal: J Ethnopharmacol | Authors: Li Gao | Species: rat | Application: WB - Nao-Xin-Tong Capsule alleviates astrocyte end-foot swelling after cerebral ischemia-reperfusion injury via NF-κB/MMP9/AQP4 signal and NF-κB/CXCL12/CXCR4 signal.
Journal: J Ethnopharmacol | Authors: Jinfeng Shang | Species: rat | Application: WB,IF - Effective-components combination alleviates PM2.5-induced inflammation by evoking macrophage autophagy in COPD
Journal: J Ethnopharmacol | Authors: Jing Wang | Species: mouse | Application: WB - Yang-Xin-Shu-Mai granule alleviates atherosclerosis by regulating macrophage polarization via the TLR9/MyD88/NF-κB signaling pathway
Journal: J Ethnopharmacol | Authors: Hong Huang | Species: mouse | Application: WB,IF - Buyang Huanwu Decoction alleviates vascular cognitive impairment by inhibiting neuroinflammation via regulation of the p53/cGAS/STING pathway.
Journal: J Ethnopharmacol | Authors: Huijuan Luo - Ethnopharmacological relevance and anti-inflammatory mechanisms of Lycopi Herba in diabetic nephropathy: Integrated chemical profiling and pharmacological evaluation.
Journal: J Ethnopharmacol | Authors: Lu-Zhou Chen | Species: mouse | Application: WB - Huatanhuoxue Decoction alleviates airway inflammation by regulating IL-17A signaling pathway in obese asthmatic mice
Journal: J Ethnopharmacol | Authors: Yun Sun | Application: WB - Dietary Isoquercetin Ameliorates Bone Loss via Restoration of the Gut Microbiota and Lipopolysaccharide-Triggered Inflammatory Status in Ovariectomy Mice
Journal: J Agric Food Chem | Authors: Mengjing Wu | Species: mouse | Application: WB,IF - Ocotillol-Type Pseudoginsenoside-F11 Alleviates Lipopolysaccharide-Induced Acute Kidney Injury through Regulation of Macrophage Function by Suppressing the NF-κB/NLRP3/IL-1β Signaling Pathway
Journal: J Agric Food Chem | Authors: Yaru Wang | Species: mouse | Application: WB - Ginsenoside Rk3 Treats Corneal Injury Through the HMGB1/TLR4/NF-κB Pathway
Journal: J Agric Food Chem | Authors: Linlin Qu | Species: human | Application: WB - Comparison of the Hepatoprotective Effects of the Three Main Stilbenes from Mulberry Twigs.
Journal: J Agric Food Chem | Authors: Ya-Nan Jia | Species: mouse | Application: WB - Engineered Exosomes Delivering bta-miR-223 Alleviate Staphylococcus aureus-Induced Mastitis in Mice via the TLR4/NF-κB Signaling Pathway
Journal: J Agric Food Chem | Authors: Yuxuan Wang | Species: mouse | Application: WB - Protection Mechanisms Underlying Oral Administration of Chlorogenic Acid against Cadmium-Induced Hepatorenal Injury Related to Regulating Intestinal Flora Balance.
Journal: J Agric Food Chem | Authors: Yixin Ding | Species: mouse | Application: WB - Expression and Biological Activity of Recombinant Type IV Collagen.
Journal: J Agric Food Chem | Authors: Yingxue Chang | Species: human | Application: IF - Naringenin Inhibits Acid Sphingomyelinase-Mediated Membrane Raft Clustering to Reduce NADPH Oxidase Activation and Vascular Inflammation
Journal: J Agric Food Chem | Authors: Meng Ding | Species: human | Application: WB - Inflammation-induced cell-secreted migrasome promotes IL-6 expression in the recipient cells.
Journal: Biomater Adv | Authors: Shogo Saito | Species: human | Application: IF - Sea Cucumber Fucoidan Inhibits Helicobacter pylori Gastritis via MAPK/NF-κB Signaling and Gut Microbiota Modulation
Journal: J Agric Food Chem | Authors: Junhan Cao | Species: mouse | Application: WB - Dietary Galacto-oligosaccharides Ameliorate Atopic Dermatitis-like Skin Inflammation and Behavioral Deficits by Modulating Gut Microbiota-Brain-Skin Axis
Journal: J Agric Food Chem | Authors: Liu Tang | Species: mouse | Application: IHC - Development of ellagic acid-derived bismuth MOF for targeted therapy in colitis.
Journal: Biomater Adv | Authors: Yinan Wang | Species: mouse | Application: WB - Gingerol Reverses the Cancer-Promoting Effect of Capsaicin by Increased TRPV1 Level in a Urethane-Induced Lung Carcinogenic Model.
Journal: J Agric Food Chem | Authors: Shengnan Geng | Species: mouse | Application: WB - Ginsenoside Rk3 Treats Corneal Injury Through the HMGB1/TLR4/NF-κB Pathway
Journal: J Agric Food Chem | Authors: Linlin Qu | Species: human | Application: WB - Hyperoside Alleviates Free Fatty Acid-Induced Inflammatory Damage and Tight Junction Disruption in Mammary Epithelial Cells by Regulating Nuclear Factor Erythroid 2-Related Factor 1.
Journal: J Agric Food Chem | Authors: Taiyu Shen | Species: bovine | Application: WB - Protection Mechanisms Underlying Oral Administration of Chlorogenic Acid against Cadmium-Induced Hepatorenal Injury Related to Regulating Intestinal Flora Balance.
Journal: J Agric Food Chem | Authors: Yixin Ding | Species: mouse | Application: WB - Orally Administered Ginkgolide C Alleviates MPTP-Induced Neurodegeneration by Suppressing Neuroinflammation and Oxidative Stress through Microbiota-Gut-Brain Axis in Mice
Journal: J Agric Food Chem | Authors: Xiyu Gao | Species: mouse | Application: WB,IF - Allicin Ameliorates Intestinal Barrier Damage via Microbiota-Regulated Short-Chain Fatty Acids-TLR4/MyD88/NF-κB Cascade Response in Acrylamide-Induced Rats
Journal: J Agric Food Chem | Authors: Yuan Yuan | Species: rat | Application: WB - Design, synthesis, and evaluation of indole-pyridine chalcone derivatives as novel HK2 inhibitors to modulate macrophage glycolysis and inflammation for IBD treatment.
Journal: Eur J Med Chem | Authors: Yawei Han | Species: mouse | Application: WB,IF - Salidroside Ameliorates Furan-Induced Testicular Inflammation in Relation to the Gut-Testis Axis and Intestinal Apoptosis
Journal: J Agric Food Chem | Authors: Ziyue Wang | Species: mouse | Application: WB - Ocotillol-Type Pseudoginsenoside-F11 Alleviates Lipopolysaccharide-Induced Acute Kidney Injury through Regulation of Macrophage Function by Suppressing the NF-κB/NLRP3/IL-1β Signaling Pathway
Journal: J Agric Food Chem | Authors: Yaru Wang | Species: mouse | Application: WB - Diosmetin Ameliorates Nonalcoholic Steatohepatitis through Modulating Lipogenesis and Inflammatory Response in a STAT1/CXCL10-Dependent Manner.
Journal: J Agric Food Chem | Authors: Nanxuan Luo | Species: mouse,human | Application: WB - Hydroxytyrosol Alleviates Dextran Sulfate Sodium-Induced Colitis by Modulating Inflammatory Responses, Intestinal Barrier, and Microbiome.
Journal: J Agric Food Chem | Authors: Qun Wang | Application: WB - Ocotillol-Type Pseudoginsenoside-F11 Alleviates Lipopolysaccharide-Induced Acute Kidney Injury through Regulation of Macrophage Function by Suppressing the NF-κB/NLRP3/IL-1β Signaling Pathway
Journal: J Agric Food Chem | Authors: Yaru Wang | Species: mouse | Application: WB - Allicin Ameliorates Intestinal Barrier Damage via Microbiota-Regulated Short-Chain Fatty Acids-TLR4/MyD88/NF-κB Cascade Response in Acrylamide-Induced Rats
Journal: J Agric Food Chem | Authors: Yuan Yuan | Species: rat | Application: WB - Dietary Isoquercetin Ameliorates Bone Loss via Restoration of the Gut Microbiota and Lipopolysaccharide-Triggered Inflammatory Status in Ovariectomy Mice
Journal: J Agric Food Chem | Authors: Mengjing Wu | Species: mouse | Application: WB,IF - Gingerol Reverses the Cancer-Promoting Effect of Capsaicin by Increased TRPV1 Level in a Urethane-Induced Lung Carcinogenic Model.
Journal: J Agric Food Chem | Authors: Shengnan Geng | Species: mouse | Application: WB - Development of ellagic acid-derived bismuth MOF for targeted therapy in colitis.
Journal: Biomater Adv | Authors: Yinan Wang | Species: mouse | Application: WB - β-Conglycinin-Induced Intestinal Porcine Epithelial Cell Damage via the Nuclear Factor κB/Mitogen-Activated Protein Kinase Signaling Pathway
Journal: J Agric Food Chem | Authors: Chenglu Peng | Species: pig | Application: WB - Diosmetin Ameliorates Nonalcoholic Steatohepatitis through Modulating Lipogenesis and Inflammatory Response in a STAT1/CXCL10-Dependent Manner.
Journal: J Agric Food Chem | Authors: Nanxuan Luo | Species: mouse,human | Application: WB - An Isofibrous Diet with Fiber Konjac Glucomannan Ameliorates Salmonella typhimurium-Induced Colonic Injury by Regulating TLR2-NF-κB Signaling and Intestinal Microbiota in Mice
Journal: J Agric Food Chem | Authors: Jun Li | Species: mouse | Application: WB - Dietary Galacto-oligosaccharides Ameliorate Atopic Dermatitis-like Skin Inflammation and Behavioral Deficits by Modulating Gut Microbiota-Brain-Skin Axis
Journal: J Agric Food Chem | Authors: Liu Tang | Species: mouse | Application: IHC - Ketogenic Diet Elicits Antitumor Properties through Inducing Oxidative Stress, Inhibiting MMP-9 Expression, and Rebalancing M1/M2 Tumor-Associated Macrophage Phenotype in a Mouse Model of Colon Cancer.
Journal: J Agric Food Chem | Authors: Ning Zhang | Species: human | Application: WB - Protection Mechanisms Underlying Oral Administration of Chlorogenic Acid against Cadmium-Induced Hepatorenal Injury Related to Regulating Intestinal Flora Balance.
Journal: J Agric Food Chem | Authors: Yixin Ding | Species: mouse | Application: WB - Biotransformation of 18β-Glycyrrhetinic Acid by Human Intestinal Fungus Aspergillus niger RG13B1 and the Potential Anti-Inflammatory Mechanism of Its Metabolites
Journal: J Agric Food Chem | Authors: Min Zhang | Species: mouse | Application: WB - Ginsenoside Rg5 Improves Insulin Resistance and Mitochondrial Biogenesis of Liver via Regulation of the Sirt1/PGC-1α Signaling Pathway in db/db Mice.
Journal: J Agric Food Chem | Authors: Yanyan Zhu | Species: mouse,human | Application: WB - Tetrabromophthalate bis(2-ethylhexyl) ester (TBPH) exposure induces renal inflammation injury by activating MAVS-IRF3 signaling pathway in vitro and in vivo models
Journal: Ecotoxicol Environ Saf | Authors: Baopeng Xing | Species: mouse,human - Astaxanthin attenuates AFB1-induced hepatotoxicity by activating Nrf2 and inhibiting the NF-κB signaling pathway
Journal: Ecotoxicol Environ Saf | Authors: Kai Kang - Cardiotoxicity of polystyrene nanoplastics and associated mechanism of myocardial cell injury in mice
Journal: Ecotoxicol Environ Saf | Authors: Ziyi Xiong | Species: rat,mouse | Application: WB - Copper induces oxidative stress with triggered NF-κB pathway leading to inflammatory responses in immune organs of chicken.
Journal: Ecotoxicol Environ Saf | Authors: Fan Yang | Species: chicken | Application: WB - Long-term copper exposure induced pyroptosis and inflammation of rat spleen through intestinal-splenic axis
Journal: Ecotoxicol Environ Saf | Authors: Jinwen Quan | Species: rat | Application: WB - Bta-miR-149-3p suppresses inflammatory response in bovine Sertoli cells exposed to microcystin-leucine arginine (MC-LR) through TLR4/NF-kB signaling pathway
Journal: Ecotoxicol Environ Saf | Authors: Wang Xue | Species: bovine | Application: WB - Morinda officinalis oligosaccharides alleviate depressive-like behaviors in post-stroke rats via suppressing NLRP3 inflammasome to inhibit hippocampal inflammation.
Journal: CNS Neurosci Ther | Authors: Zhifang Li | Species: rat | Application: WB,IF - Inhibition of ASIC1a Attenuates Neuronal Pyroptosis and Neuroinflammation Following Traumatic Brain Injury.
Journal: CNS Neurosci Ther | Authors: Jiawei Liang | Species: mouse | Application: WB - Low-dose arsenite causes overexpression of EGF, TGFα, and HSP90 through Trx1-TXNIP-NLRP3 axis mediated signaling pathways in the human bladder epithelial cells
Journal: Ecotoxicol Environ Saf | Authors: Peiyu Jin | Species: human | Application: WB - Tetrabromophthalate bis(2-ethylhexyl) ester (TBPH) exposure induces renal inflammation injury by activating MAVS-IRF3 signaling pathway in vitro and in vivo models
Journal: Ecotoxicol Environ Saf | Authors: Baopeng Xing | Species: mouse,human - Multi-omics analysis explore the mechanism of deoxynivalenol inhibiting rabbit appetite through microbial-gut-brain axis
Journal: Ecotoxicol Environ Saf | Authors: Xuejun Yuan | Species: rabbit | Application: WB - Morinda officinalis oligosaccharides alleviate depressive-like behaviors in post-stroke rats via suppressing NLRP3 inflammasome to inhibit hippocampal inflammation.
Journal: CNS Neurosci Ther | Authors: Zhifang Li | Species: rat | Application: WB,IF - Acrylamide exposure induces neurotoxicity via the PI3K/Akt/NF-κB pathway: Evidence from network toxicology and experimental validation.
Journal: Ecotoxicol Environ Saf | Authors: Zhaoda Duan | Species: mouse | Application: WB - Cardiotoxicity of polystyrene nanoplastics and associated mechanism of myocardial cell injury in mice
Journal: Ecotoxicol Environ Saf | Authors: Ziyi Xiong | Species: rat,mouse | Application: WB - Long-term copper exposure induced pyroptosis and inflammation of rat spleen through intestinal-splenic axis
Journal: Ecotoxicol Environ Saf | Authors: Jinwen Quan | Species: rat | Application: WB - Hexavalent chromium triggers hepatocytes premature senescence via the GATA4/NF-κB signaling pathway mediated by the DNA damage response.
Journal: Ecotoxicol Environ Saf | Authors: Yu Ma | Species: mouse,human | Application: WB - Exercise antagonizes cadmium-caused liver and intestinal injury in mice via Nrf2 and TLR2/NF-κB signalling pathway
Journal: Ecotoxicol Environ Saf | Authors: Ding Zhang | Species: mouse | Application: WB - Multi-omics analysis explore the mechanism of deoxynivalenol inhibiting rabbit appetite through microbial-gut-brain axis
Journal: Ecotoxicol Environ Saf | Authors: Xuejun Yuan | Species: rabbit | Application: WB - Morinda officinalis oligosaccharides alleviate depressive-like behaviors in post-stroke rats via suppressing NLRP3 inflammasome to inhibit hippocampal inflammation.
Journal: CNS Neurosci Ther | Authors: Zhifang Li | Species: rat | Application: WB,IF - S-COS-Se mitigates cadmium-induced oxidative stress, inflammation, and immunotoxicity by restoring immune balance and inhibiting mitochondria-pyroptosis crosstalk
Journal: Ecotoxicol Environ Saf | Authors: Hao Zheng | Species: rat | Application: WB - Phthalate exposure aggravates periodontitis by activating NFκB pathway
Journal: Ecotoxicol Environ Saf | Authors: Wei Wu | Species: mouse | Application: WB,IF - Multi-walled carbon nanotubes decrease neuronal NO synthase in 3D brain organoids.
Journal: Sci Total Environ | Authors: Ying Jiang | Species: human | Application: WB - Arsenic exposure induces intestinal barrier damage and consequent activation of gut-liver axis leading to inflammation and pyroptosis of liver in ducks.
Journal: Sci Total Environ | Authors: Gaolong Zhong | Application: WB - Betulinic acid suppresses breast cancer aerobic glycolysis via caveolin-1/NF-κB/c-Myc pathway.
Journal: Biochem Pharmacol | Authors: Lin Jiao | Species: human | Application: WB,IF - Quercetin ameliorates SIRT1-mediated oxidative stress and inflammation to attenuate ciliary muscle remodeling in experimental myopia.
Journal: Biochem Pharmacol | Authors: Yuanting Yang | Application: WB - Targeting DYRK1A with harmine abrogates the FOXO1-NF-κB axis to alleviate cellular senescence and renal fibrosis.
Journal: Mech Ageing Dev | Authors: Pengfei Qiao | Species: human | Application: WB - Dapagliflozin ameliorates diabetic kidney disease by inhibiting oxidative stress and AIM2-dependent pyroptosis via SIRT1 activation.
Journal: Biochem Pharmacol | Authors: Hao Wang - Gelofusine Attenuates Tubulointerstitial Injury Induced by cRGD-Conjugated siRNA by Regulating the TLR3 Signaling Pathway.
Journal: Mol Ther Nucleic Acids | Authors: Bohong Cen | Species: mouse | Application: WB,IHC,IF - The miR-623/CXCL12 axis inhibits LPS-induced nucleus pulposus cell apoptosis and senescence.
Journal: Mech Ageing Dev | Authors: Hua Zhong | Species: human | Application: WB - Dexamethasone upregulates macrophage PIEZO1 via SGK1, suppressing inflammation and increasing ROS and apoptosis
Journal: Biochem Pharmacol | Authors: Hailin Liu | Species: mouse | Application: WB - miR-204-5p Represses Bone Metastasis via Inactivating NF-κB Signaling in Prostate Cancer.
Journal: Mol Ther Nucleic Acids | Authors: Qingde Wa | Species: human | Application: WB - Insufficient BK channel function enhances NF-κB nuclear translocation and promotes IL-6 synthesis in vascular smooth muscle cells induced by AT1-AA
Journal: Biochem Pharmacol | Authors: Yang Li | Species: rat | Application: WB,IF - From stem cells to skin: ADSCP6 peptide's role in transforming scar therapy
Journal: Biochem Pharmacol | Authors: Jun Li | Species: mouse | Application: WB - Rhapontigenin attenuates neurodegeneration in a parkinson's disease model by downregulating mtDNA-cGAS-STING-NF-κB-mediated neuroinflammation via PINK1/DRP1-dependent microglial mitophagy
Journal: Cell Mol Life Sci | Authors: Zhongqiang Su - Rhapontigenin attenuates neurodegeneration in a parkinson's disease model by downregulating mtDNA-cGAS-STING-NF-κB-mediated neuroinflammation via PINK1/DRP1-dependent microglial mitophagy
Journal: Cell Mol Life Sci | Authors: Zhongqiang Su - Dapagliflozin ameliorates diabetic kidney disease by inhibiting oxidative stress and AIM2-dependent pyroptosis via SIRT1 activation.
Journal: Biochem Pharmacol | Authors: Hao Wang - The tryptophan metabolite indole 3-propionic acid alleviates lung ischemia-reperfusion injury via prostaglandin reductase 2 in male mice.
Journal: Biochem Pharmacol | Authors: Kai Guo | Species: mouse | Application: WB - Alpha-lipoamide prevents acute kidney injury in mouse by inhibiting renal tubular epithelial cell pyroptosis
Journal: Biochem Pharmacol | Authors: Wan-Lin Tan | Species: mouse | Application: WB - miR-204-5p Represses Bone Metastasis via Inactivating NF-κB Signaling in Prostate Cancer.
Journal: Mol Ther Nucleic Acids | Authors: Qingde Wa | Species: human | Application: WB - Dexamethasone upregulates macrophage PIEZO1 via SGK1, suppressing inflammation and increasing ROS and apoptosis
Journal: Biochem Pharmacol | Authors: Hailin Liu | Species: mouse | Application: WB - Dynorphin activation of kappa opioid receptor promotes microglial polarization toward M2 phenotype via TLR4/NF-κB pathway.
Journal: Cell Biosci | Authors: Lin Liu | Species: mouse | Application: WB - Alpha-lipoamide prevents acute kidney injury in mouse by inhibiting renal tubular epithelial cell pyroptosis
Journal: Biochem Pharmacol | Authors: Wan-Lin Tan | Species: mouse | Application: WB - Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways.
Journal: Biochem Pharmacol | Authors: Bin Zhu | Species: human | Application: WB - Dexamethasone upregulates macrophage PIEZO1 via SGK1, suppressing inflammation and increasing ROS and apoptosis
Journal: Biochem Pharmacol | Authors: Hailin Liu | Species: mouse | Application: WB - miR-204-5p Represses Bone Metastasis via Inactivating NF-κB Signaling in Prostate Cancer.
Journal: Mol Ther Nucleic Acids | Authors: Qingde Wa | Species: human | Application: WB - Lack of ALCAT1 enhances the protective effects of aerobic exercise on kidney in HFpEF mice
Journal: Life Sci | Authors: Lili Zhang | Species: mouse | Application: WB - The potential of Diosgenin in treating psoriasis: Studies from HaCaT keratinocytes and imiquimod-induced murine model.
Journal: Life Sci | Authors: Shidi Wu | Species: human | Application: WB - Protective function of exosomes from adipose tissue-derived mesenchymal stem cells in acute kidney injury through SIRT1 pathway.
Journal: Life Sci | Authors: Fang Gao | Species: mouse | Application: WB - Identification of EGR4 as a prospective target for inhibiting tumor cell proliferation and a novel biomarker in colorectal cancer
Journal: Cancer Gene Ther | Authors: Bangting Wang | Species: human | Application: WB,IF - Endothelial RGS12 governs angiogenesis in inflammatory arthritis by controlling cilia formation and elongation via MYCBP2 signaling
Journal: Cell Insight | Authors: Gongsheng Yuan | Species: mouse | Application: WB - Activation of AMPK prevents monocrotaline-induced pulmonary arterial hypertension by suppression of NF-κB-mediated autophagy activation.
Journal: Life Sci | Authors: Cui Zhai | Species: rat | Application: WB - Ultrasound targeted microbubble destruction-assisted mesoporous silicon delivery of dexamethasone inhibits ulcerative colitis by regulating the MTDH/ACSL4/NF-κB pathway.
Journal: Life Sci | Authors: Kai Kang | Species: mouse,human | Application: WB - Karyopherin α 2 promotes proliferation, migration and invasion through activating NF-κB/p65 signaling pathways in melanoma cells.
Journal: Life Sci | Authors: Fan Yang | Species: human | Application: WB,IF - The potential of Diosgenin in treating psoriasis: Studies from HaCaT keratinocytes and imiquimod-induced murine model.
Journal: Life Sci | Authors: Shidi Wu | Species: human | Application: WB - A multi-omics analysis of viral nucleic acid poly(I:C) responses to mammalian testicular stimulation
Journal: Stress Biol | Authors: Donghui Yang | Species: mouse | Application: IHC - Rosmarinic acid attenuates inflammatory responses through inhibiting HMGB1/TLR4/NF-κB signaling pathway in a mouse model of Parkinson's disease.
Journal: Life Sci | Authors: Runxiao Lv | Species: mouse | Application: WB - HUCMSCs transplantation combined with ultrashort wave therapy attenuates neuroinflammation in spinal cord injury through NUR77/ NF-κB pathway.
Journal: Life Sci | Authors: Shuai Wang | Species: rat | Application: WB - Identification of EGR4 as a prospective target for inhibiting tumor cell proliferation and a novel biomarker in colorectal cancer
Journal: Cancer Gene Ther | Authors: Bangting Wang | Species: human | Application: WB,IF - Karyopherin α 2 promotes proliferation, migration and invasion through activating NF-κB/p65 signaling pathways in melanoma cells.
Journal: Life Sci | Authors: Fan Yang | Species: human | Application: WB,IF - The potential of Diosgenin in treating psoriasis: Studies from HaCaT keratinocytes and imiquimod-induced murine model.
Journal: Life Sci | Authors: Shidi Wu | Species: human | Application: WB - Identification of EGR4 as a prospective target for inhibiting tumor cell proliferation and a novel biomarker in colorectal cancer
Journal: Cancer Gene Ther | Authors: Bangting Wang | Species: human | Application: WB,IF - Rosmarinic acid attenuates inflammatory responses through inhibiting HMGB1/TLR4/NF-κB signaling pathway in a mouse model of Parkinson's disease.
Journal: Life Sci | Authors: Runxiao Lv | Species: mouse | Application: WB - The MIR155 host gene/microRNA-627/HMGB1/NF-κB loop modulates fibroblast proliferation and extracellular matrix deposition.
Journal: Life Sci | Authors: Jie Li | Species: human | Application: IHC - MicroRNA-150 affects endoplasmic reticulum stress via MALAT1-miR-150 axis-mediated NF-κB pathway in LPS-challenged HUVECs and septic mice.
Journal: Life Sci | Authors: Liang Liu | Species: human | Application: WB - Salidroside alleviates acetaminophen-induced hepatotoxicity via Sirt1-mediated activation of Akt/Nrf2 pathway and suppression of NF-κB/NLRP3 inflammasome axis
Journal: Life Sci | Authors: Zhengshan Gao | Species: mouse,human | Application: WB,IF - Endothelial RGS12 governs angiogenesis in inflammatory arthritis by controlling cilia formation and elongation via MYCBP2 signaling
Journal: Cell Insight | Authors: Gongsheng Yuan | Species: mouse | Application: WB - A multi-omics analysis of viral nucleic acid poly(I:C) responses to mammalian testicular stimulation
Journal: Stress Biol | Authors: Donghui Yang | Species: mouse | Application: IHC - COMMD7 Regulates NF-κB Signaling Pathway in Hepatocellular Carcinoma Stem-like Cells.
Journal: Mol Ther Oncolytics | Authors: Lu Zheng | Species: human | Application: WB - Effects of the glucagon-like peptide-1 receptor agonist PEG-Loxe on diabetic osteoporosis: A mechanistic study.
Journal: Mol Metab | Authors: Lizhi Zhang | Species: mouse | Application: WB - Isorhamnetin ameliorates hyperuricemia by regulating uric acid metabolism and alleviates renal inflammation through the PI3K/AKT/NF-κB signaling pathway
Journal: Food Funct | Authors: Xiaoran Kong | Species: mouse | Application: WB - Anti-tumor effect of infant-derived Enterococcus via the inhibition of proliferation and inflammation as well as the promotion of apoptosis
Journal: Food Funct | Authors: Qin Yang | Species: mouse | Application: WB - ZRSR1 protects against obesity-associated hepatic lipogenesis independent of minor intron splicing.
Journal: Life Metab | Authors: Yinkun Fu | Species: mouse | Application: WB - Isorhamnetin ameliorates hyperuricemia by regulating uric acid metabolism and alleviates renal inflammation through the PI3K/AKT/NF-κB signaling pathway
Journal: Food Funct | Authors: Xiaoran Kong | Species: mouse | Application: WB - Allantoin ameliorates dopaminergic neuronal damage in MPTP-induced Parkinson's disease mice via regulating oxidative damage, inflammation, and gut microbiota disorder
Journal: Food Funct | Authors: Shuo Yang | Species: mouse | Application: WB - Ketogenic diet attenuates neuroinflammation and induces conversion of M1 microglia to M2 in an EAE model of multiple sclerosis by regulating the NF-κB/NLRP3 pathway and inhibiting HDAC3 and P2X7R activation
Journal: Food Funct | Authors: Wei Sun | Species: mouse | Application: WB - Total saponins from Rosa laevigata Michx fruit attenuates hepatic steatosis induced by high-fat diet in rats.
Journal: Food Funct | Authors: Deshi Dong | Species: rat | Application: WB - Akebia Saponin D suppresses inflammation in chondrocytes via the NRF2/HO-1/NF-κB axis and ameliorates osteoarthritis in mice.
Journal: Food Funct | Authors: Mingbao Gu | Species: mouse | Application: WB,IF - Ginsenoside Rk1 induces apoptosis and downregulates the expression of PD-L1 by targeting the NF-κB pathway in lung adenocarcinoma.
Journal: Food Funct | Authors: Manling Hu | Species: human | Application: WB - Correction: Total saponins from Rosa laevigata Michx fruit attenuates hepatic steatosis induced by high-fat diet in rats.
Journal: Food Funct | Authors: Deshi Dong | Species: rat | Application: WB - Chemical characterization of a novel polysaccharide ASKP-1 from Artemisia sphaerocephala Krasch seed and its macrophage activation via MAPK, PI3k/Akt and NF-κB signaling pathways in RAW264.7 cells.
Journal: Food Funct | Authors: Daoyuan Ren | Species: mouse | Application: WB - Effects of the glucagon-like peptide-1 receptor agonist PEG-Loxe on diabetic osteoporosis: A mechanistic study.
Journal: Mol Metab | Authors: Lizhi Zhang | Species: mouse | Application: WB - γ-Oryzanol alleviates acetaminophen-induced liver injury: roles of modulating AMPK/GSK3β/Nrf2 and NF-κB signaling pathways.
Journal: Food Funct | Authors: Guangwen Shu | Species: human | Application: WB - Effects of the glucagon-like peptide-1 receptor agonist PEG-Loxe on diabetic osteoporosis: A mechanistic study.
Journal: Mol Metab | Authors: Lizhi Zhang | Species: mouse | Application: WB - DHA-phospholipids (DHA-PL) and EPA-phospholipids (EPA-PL) prevent intestinal dysfunction induced by chronic stress
Journal: Food Funct | Authors: Wanxiu Cao | Species: mouse | Application: WB - Cardamonin protects nucleus pulposus cells against IL-1β-induced inflammation and catabolism via Nrf2/NF-κB axis.
Journal: Food Funct | Authors: Chenglong Xie | Species: rat | Application: WB,IF - Total saponins from Rosa laevigata Michx fruit attenuates hepatic steatosis induced by high-fat diet in rats.
Journal: Food Funct | Authors: Deshi Dong | Species: rat | Application: WB - Diallyl trisulfide inhibits 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone-induced lung cancer via modulating gut microbiota and the PPARγ/NF-κB pathway.
Journal: Food Funct | Authors: Zhuo Qu | Species: mouse | Application: WB - Urate-lowering and renal-protective effects of sugarcane polyphenols in hyperuricemia: mechanisms and key components
Journal: Food Funct | Authors: Kexin Li | Species: rat | Application: WB - Long-term Pu-erh tea consumption improves blue light-induced depression-like behaviors
Journal: Food Funct | Authors: Sibo Zhao | Species: mouse | Application: WB - Correction: Total saponins from Rosa laevigata Michx fruit attenuates hepatic steatosis induced by high-fat diet in rats.
Journal: Food Funct | Authors: Deshi Dong | Species: rat | Application: WB - Ketogenic diet attenuates neuroinflammation and induces conversion of M1 microglia to M2 in an EAE model of multiple sclerosis by regulating the NF-κB/NLRP3 pathway and inhibiting HDAC3 and P2X7R activation
Journal: Food Funct | Authors: Wei Sun | Species: mouse | Application: WB - Urate-lowering and renal-protective effects of sugarcane polyphenols in hyperuricemia: mechanisms and key components
Journal: Food Funct | Authors: Kexin Li | Species: rat | Application: WB - Gastroprotective effects of ginsenoside Rh4 against ethanol-induced gastric mucosal injury by inhibiting the MAPK/NF-κB signaling pathway
Journal: Food Funct | Authors: Yuqing Wu | Species: rat | Application: WB - Betaine supplementation alleviates dextran sulfate sodium-induced colitis via regulating the inflammatory response, enhancing the intestinal barrier, and altering gut microbiota
Journal: Food Funct | Authors: Nannan Zhao | Species: mouse | Application: WB - Adjuvant treatment and molecular mechanism of probiotic compounds in patients with gastric cancer after gastrectomy.
Journal: Food Funct | Authors: Cihua Zheng | Species: rat | Application: WB - Isorhamnetin ameliorates hyperuricemia by regulating uric acid metabolism and alleviates renal inflammation through the PI3K/AKT/NF-κB signaling pathway
Journal: Food Funct | Authors: Xiaoran Kong | Species: mouse | Application: WB - Long-term Pu-erh tea consumption improves blue light-induced depression-like behaviors
Journal: Food Funct | Authors: Sibo Zhao | Species: mouse | Application: WB - Platycodon grandiflorum root fermentation broth reduces inflammation in a mouse IBD model through the AMPK/NF-κB/NLRP3 pathway.
Journal: Food Funct | Authors: Zhe Wang | Application: WB - Chemical characterization of a novel polysaccharide ASKP-1 from Artemisia sphaerocephala Krasch seed and its macrophage activation via MAPK, PI3k/Akt and NF-κB signaling pathways in RAW264.7 cells.
Journal: Food Funct | Authors: Daoyuan Ren | Species: mouse | Application: WB - Ginsenoside compound K alleviates D-galactose-induced mild cognitive impairment by modulating gut microbiota-mediated short-chain fatty acid metabolism
Journal: Food Funct | Authors: Xiaojun Yan | Species: mouse | Application: WB - Gngt2 promotes inflammatory dendritic cell programming through an ATG5-NF-κB signaling axis in neutrophilic asthma.
Journal: Inflamm Res | Authors: Xiaoying Ji | Species: mouse | Application: WB - Lp-PLA2-derived LysoPC drives dendritic cell immunogenic activation and Th17 inflammation in severe asthma.
Journal: Inflamm Res | Authors: Fang Wang | Species: mouse | Application: WB - Mammalian STE20-like kinase 1 inhibits synoviocytes activation in rheumatoid arthritis through mitochondrial dysfunction mediated by SIRT3/mTOR axis
Journal: Inflamm Res | Authors: Min Tan | Species: human | Application: WB - Tissue-resident C1q + macrophages exert anti-aging potential through the Sirt1 pathway
Journal: Inflamm Res | Authors: Liang Liu | Species: human | Application: WB - A hybrid membrane coating nanodrug system against gastric cancer via the VEGFR2/STAT3 signaling pathway
Journal: J Mater Chem B | Authors: Ying Long | Species: human | Application: WB - TIPE2 ameliorates lipopolysaccharide-induced apoptosis and inflammation in acute lung injury.
Journal: Inflamm Res | Authors: Xiaojing Wu | Species: mouse | Application: WB - Long non-coding RNA MIDEAS-AS1 inhibits growth and metastasis of triple-negative breast cancer via transcriptionally activating NCALD
Journal: Breast Cancer Res | Authors: Dan Luo | Species: human | Application: WB - TIPE2 ameliorates lipopolysaccharide-induced apoptosis and inflammation in acute lung injury.
Journal: Inflamm Res | Authors: Xiaojing Wu | Species: mouse | Application: WB - Thalidomide Alleviates Apoptosis, Oxidative Damage and Inflammation Induced by Pemphigus Vulgaris IgG in HaCat Cells and Neonatal Mice Through MyD88
Journal: Drug Des Devel Ther | Authors: Chunyan Luan | Species: human | Application: WB - Ginsenoside Rb1 Alleviates DSS-Induced Ulcerative Colitis by Protecting the Intestinal Barrier Through the Signal Network of VDR, PPARγ and NF-κB
Journal: Drug Des Devel Ther | Authors: Yi Zhou | Species: mouse | Application: WB - Emodin Protects Against Acute Pancreatitis-Associated Lung Injury by Inhibiting NLPR3 Inflammasome Activation via Nrf2/HO-1 Signaling.
Journal: Drug Des Devel Ther | Authors: Zhenming Gao | Species: rat | Application: WB - Integrative Network Pharmacology and Transcriptomics Reveal the Mechanism of Gui-Qi-Yi-Shen Granules in the Treatment of IgA Nephropathy
Journal: Drug Des Devel Ther | Authors: Jia-Wei Cao | Species: mouse | Application: WB,IF - Network Pharmacology and Experimental Verification: Phellodendri Chinensis Cortex-Cnidii Fructus Herb Pair Alleviates Atopic Dermatitis by Regulating the TLR4/NF-κB Pathway
Journal: Drug Des Devel Ther | Authors: Xinyue Liu | Species: human | Application: WB,IF - α-Mangostin Inhibited M1 Polarization of Macrophages/Monocytes in Antigen-Induced Arthritis Mice by Up-Regulating Silent Information Regulator 1 and Peroxisome Proliferators-Activated Receptor γ Simultaneously
Journal: Drug Des Devel Ther | Authors: Yi-Jin Wu | Species: human | Application: WB - Lobetyolin Suppressed Osteoclastogenesis and Alleviated Bone Loss in Ovariectomy-Induced Osteoporosis via Hindering p50/p65 Nuclear Translocation and Downstream NFATc1/c-Fos Expression
Journal: Drug Des Devel Ther | Authors: Chunmei Xiu | Species: mouse | Application: WB,IF - Ginsenoside Rb1 Alleviates DSS-Induced Ulcerative Colitis by Protecting the Intestinal Barrier Through the Signal Network of VDR, PPARγ and NF-κB
Journal: Drug Des Devel Ther | Authors: Yi Zhou | Species: mouse | Application: WB - Study on the Underlying Mechanism of Yinhua Gout Granules in the Treatment of Gouty Arthritis by Integrating Transcriptomics and Network Pharmacology
Journal: Drug Des Devel Ther | Authors: Qiang-Qiang Fan | Species: rat | Application: WB - The Protective Effect of Selenium Nanoparticles in Osteoarthritis: In vitro and in vivo Studies
Journal: Drug Des Devel Ther | Authors: Yong Li | Species: mouse | Application: WB - The Protective Effect of Selenium Nanoparticles in Osteoarthritis: In vitro and in vivo Studies
Journal: Drug Des Devel Ther | Authors: Yong Li | Species: mouse | Application: WB - Exosomes Derived From Bone Marrow Mesenchymal Stem Cells Inhibit Complement Activation In Rats With Spinal Cord Injury.
Journal: Drug Des Devel Ther | Authors: Chuanliang Zhao | Species: rat | Application: WB - Xinfeng Capsule Inhibits Pyroptosis and Ameliorates Myocardial Injury in Rats with Adjuvant Arthritis via the GAS5/miR-21/TLR4 Axis
Journal: Drug Des Devel Ther | Authors: Wanlan Fu | Species: rat - α-Mangostin Inhibited M1 Polarization of Macrophages/Monocytes in Antigen-Induced Arthritis Mice by Up-Regulating Silent Information Regulator 1 and Peroxisome Proliferators-Activated Receptor γ Simultaneously
Journal: Drug Des Devel Ther | Authors: Yi-Jin Wu | Species: human | Application: WB - Emodin Protects Against Acute Pancreatitis-Associated Lung Injury by Inhibiting NLPR3 Inflammasome Activation via Nrf2/HO-1 Signaling.
Journal: Drug Des Devel Ther | Authors: Zhenming Gao | Species: rat | Application: WB - Lobetyolin Suppressed Osteoclastogenesis and Alleviated Bone Loss in Ovariectomy-Induced Osteoporosis via Hindering p50/p65 Nuclear Translocation and Downstream NFATc1/c-Fos Expression
Journal: Drug Des Devel Ther | Authors: Chunmei Xiu | Species: mouse | Application: WB,IF - Qiangli Wuhu mixture alleviates LPS-induced pneumonia by inhibiting the TLR4/NF-κB/NLRP3 pathway: a study based on network pharmacology.
Journal: Pharm Biol | Authors: Jie Tian | Species: mouse | Application: WB - RNF144A promotes antiviral responses by modulating STING ubiquitination
Journal: EMBO Rep | Authors: Bo Yang | Species: human | Application: WB - Effects of Adipose-Derived Mesenchymal Stem Cell-Secretome on Pyroptosis of Laparoscopic Hepatic Ischemia Reperfusion Injury in a Porcine Model
Journal: Cells | Authors: Yajun Ma | Species: pig | Application: WB - Catalpol relieved angiotensin II-induced blood–brain barrier destruction via inhibiting the TLR4 pathway in brain endothelial cells
Journal: Pharm Biol | Authors: Yu Xia | Species: mouse | Application: IF - Sea Cucumber Hydrolysate Alleviates Immunosuppression and Gut Microbiota Imbalance Induced by Cyclophosphamide in Balb/c Mice through the NF-κB Pathway
Journal: Foods | Authors: Jing Mao | Species: mouse | Application: WB - Protective Effect of Ginsenoside CK against Autoimmune Hepatitis Induced by Concanavalin A
Journal: Foods | Authors: Jingjing Zhang | Species: mouse | Application: WB - Hepatoprotective effects of Camellia nitidissima aqueous ethanol extract against CCl4-induced acute liver injury in SD rats related to Nrf2 and NF-κB signalling.
Journal: Pharm Biol | Authors: Xiaoman Zhang | Species: rat | Application: WB,IHC - Lycopene-Loaded Bilosomes Ameliorate High-Fat Diet-Induced Chronic Nephritis in Mice through the TLR4/MyD88 Inflammatory Pathway
Journal: Foods | Authors: Chang Liu | Species: mouse | Application: WB - Clostridium Butyricum ZJU-F1 Benefits the Intestinal Barrier Function and Immune Response Associated with Its Modulation of Gut Microbiota in Weaned Piglets.
Journal: Cells | Authors: Jie Fu | Species: pig | Application: WB - Catalpol relieved angiotensin II-induced blood–brain barrier destruction via inhibiting the TLR4 pathway in brain endothelial cells
Journal: Pharm Biol | Authors: Yu Xia | Species: mouse | Application: IF - Gelatin/Graphene Oxide Cryogel as an Artificial Cartilage Substitute Regulates Chondrogenesis and Oxidative Phosphorylation for Osteoarthritis Treatment.
Journal: ACS Biomater Sci Eng | Authors: Chao Qi - Isoalantolactone (IAL) Regulates Neuro-Inflammation and Neuronal Apoptosis to Curb Pathology of Parkinson's Disease
Journal: Cells | Authors: Dewei He | Species: mouse | Application: WB - Indirubin regulates M1/M2 polarization and inhibits ferroptosis in dextran sulfate sodium induced colitis and in cultured THP-1 cells.
Journal: Pharm Biol | Authors: Yong-xiang Huang | Species: human | Application: WB - RNF144A promotes antiviral responses by modulating STING ubiquitination
Journal: EMBO Rep | Authors: Bo Yang | Species: human | Application: WB - Theabrownin Isolated from Pu-Erh Tea Enhances the Innate Immune and Anti-Inflammatory Effects of RAW264.7 Macrophages via the TLR2/4-Mediated Signaling Pathway
Journal: Foods | Authors: Lei Zhao | Species: human | Application: WB - Sea Cucumber Hydrolysate Alleviates Immunosuppression and Gut Microbiota Imbalance Induced by Cyclophosphamide in Balb/c Mice through the NF-κB Pathway
Journal: Foods | Authors: Jing Mao | Species: mouse | Application: WB - Isoalantolactone (IAL) Regulates Neuro-Inflammation and Neuronal Apoptosis to Curb Pathology of Parkinson's Disease
Journal: Cells | Authors: Dewei He | Species: mouse | Application: WB - Gelatin/Graphene Oxide Cryogel as an Artificial Cartilage Substitute Regulates Chondrogenesis and Oxidative Phosphorylation for Osteoarthritis Treatment.
Journal: ACS Biomater Sci Eng | Authors: Chao Qi - Sea Cucumber Hydrolysate Alleviates Immunosuppression and Gut Microbiota Imbalance Induced by Cyclophosphamide in Balb/c Mice through the NF-κB Pathway
Journal: Foods | Authors: Jing Mao | Species: mouse | Application: WB - CXCR3 Inhibition Blocks the NF-κB Signaling Pathway by Elevating Autophagy to Ameliorate Lipopolysaccharide-Induced Intestinal Dysfunction in Mice
Journal: Cells | Authors: Cheng Zhang | Species: pig,mouse | Application: WB,IF - Lactobacillus murinus ZNL-13 Modulates Intestinal Barrier Damage and Gut Microbiota in Cyclophosphamide-Induced Immunosuppressed Mice
Journal: Foods | Authors: Yihan Dong | Species: mouse | Application: WB - S100A8-Mediated NLRP3 Inflammasome-Dependent Pyroptosis in Macrophages Facilitates Liver Fibrosis Progression
Journal: Cells | Authors: Yan Liu | Species: human | Application: WB - Sequential system based on ferritin delivery system and cell therapy for modulating the pathological microenvironment and promoting recovery
Journal: Int J Pharm | Authors: Lixing Xu | Species: human | Application: WB - Long-Term Treatment with Low-Level Arsenite Induces Aberrant Proliferation and Migration via Redox Rebalance in Human Urothelial Cells
Journal: Cells | Authors: Xiangli Yan - Physicochemical Characterization and Immunomodulatory Effect of Melanoidins from Vinegar Residue.
Journal: Foods | Authors: Qidan Chen | Species: mouse | Application: WB - Protective effect of hydroxysafflor yellow A on dopaminergic neurons against 6-hydroxydopamine, activating anti-apoptotic and anti-neuroinflammatory pathways.
Journal: Pharm Biol | Authors: Xiaomei Yang | Species: mouse,human | Application: WB - Hepatoprotective effects of Camellia nitidissima aqueous ethanol extract against CCl4-induced acute liver injury in SD rats related to Nrf2 and NF-κB signalling.
Journal: Pharm Biol | Authors: Xiaoman Zhang | Species: rat | Application: WB,IHC - Zr-porphyrinic MOF PCN-224 enables sequential antibacterial and inflammation-modulating PDT for periodontitis.
Journal: Colloids Surf B Biointerfaces | Authors: Qi Liu | Species: mouse | Application: IF - Biomimetic NO Scavenging Hyaluronic Acid Nanoparticles Enable Targeted Delivery of MTX and Integrated Management of Rheumatoid Arthritis
Journal: Biomacromolecules | Authors: Yilin Liu | Species: mouse | Application: IF - Dihydromyricetin Nanoparticles Alleviate Lipopolysaccharide-Induced Acute Kidney Injury by Decreasing Inflammation and Cell Apoptosis via the TLR4/NF-κB Pathway
Journal: J Funct Biomater | Authors: Hongmei Yin | Species: mouse | Application: WB - Sodium Butyrate Abrogates the Growth and Pathogenesis of Mycobacterium bovis via Regulation of Cathelicidin (LL37) Expression and NF-κB Signaling.
Journal: Front Microbiol | Authors: Kai Zhang | Species: human | Application: WB - Protective Effect of the Total Saponins from Rosa laevigata Michx Fruit against Carbon Tetrachloride-Induced Liver Fibrosis in Rats.
Journal: Nutrients | Authors: Deshi Dong | Species: rat | Application: WB - THG-1/TSC22D4 promotes interleukin-1 signaling through stabilization of TRAF6 in squamous cell carcinoma
Journal: Mol Cancer Res | Authors: Yasuhito Okano | Species: human | Application: WB,IF - Poloxamer 407 and Hyaluronic Acid Thermosensitive Hydrogel-Encapsulated Ginsenoside Rg3 to Promote Skin Wound Healing
Journal: Front Bioeng Biotechnol | Authors: Xiaojuan Peng | Species: human | Application: IF - Red Rice Seed Coat Targeting SPHK2 Ameliorated Alcoholic Liver Disease via Restored Intestinal Barrier and Improved Gut Microbiota in Mice
Journal: Nutrients | Authors: Yuxu Chen | Species: mouse | Application: WB - YTHDC1 inhibits autophagy-dependent NF-κB signaling by stabilizing Beclin1 mRNA in macrophages
Journal: J Inflamm (Lond) | Authors: Li Zhou | Species: mouse | Application: WB - L-Citrulline Supplementation Restrains Ferritinophagy-Mediated Ferroptosis to Alleviate Iron Overload-Induced Thymus Oxidative Damage and Immune Dysfunction
Journal: Nutrients | Authors: Tongtong Ba | Species: mouse | Application: WB,IF - Polyvinylpyrrolidone-Modified Taxifolin Liposomes Promote Liver Repair by Modulating Autophagy to Inhibit Activation of the TLR4/NF-κB Signaling Pathway.
Journal: Front Bioeng Biotechnol | Authors: Qiteng Ding | Species: mouse | Application: WB - Cronobacter sakazakii ATCC 29544 Translocated Human Brain Microvascular Endothelial Cells via Endocytosis, Apoptosis Induction, and Disruption of Tight Junction.
Journal: Front Microbiol | Authors: Tong Jin | Species: human | Application: IF - Poloxamer 407 and Hyaluronic Acid Thermosensitive Hydrogel-Encapsulated Ginsenoside Rg3 to Promote Skin Wound Healing
Journal: Front Bioeng Biotechnol | Authors: Xiaojuan Peng | Species: human | Application: IF - Sulforaphane Ameliorates Nonalcoholic Fatty Liver Disease Induced by High-Fat and High-Fructose Diet via LPS/TLR4 in the Gut-Liver Axis
Journal: Nutrients | Authors: Ye Xu | Species: mouse | Application: WB,IHC - RBAP48 facilitates the oral squamous cell carcinoma process in an androgen receptor-dependent and independent manners
Journal: Commun Biol | Authors: Xue Wang | Species: human | Application: WB - Red Rice Seed Coat Targeting SPHK2 Ameliorated Alcoholic Liver Disease via Restored Intestinal Barrier and Improved Gut Microbiota in Mice
Journal: Nutrients | Authors: Yuxu Chen | Species: mouse | Application: WB - L-Citrulline Supplementation Restrains Ferritinophagy-Mediated Ferroptosis to Alleviate Iron Overload-Induced Thymus Oxidative Damage and Immune Dysfunction
Journal: Nutrients | Authors: Tongtong Ba | Species: mouse | Application: WB,IF - Sodium Butyrate Abrogates the Growth and Pathogenesis of Mycobacterium bovis via Regulation of Cathelicidin (LL37) Expression and NF-κB Signaling.
Journal: Front Microbiol | Authors: Kai Zhang | Species: human | Application: WB - THG-1/TSC22D4 promotes interleukin-1 signaling through stabilization of TRAF6 in squamous cell carcinoma
Journal: Mol Cancer Res | Authors: Yasuhito Okano | Species: human | Application: WB,IF - Selenomethionine Suppressed TLR4/NF-κB Pathway by Activating Selenoprotein S to Alleviate ESBL Escherichia coli-Induced Inflammation in Bovine Mammary Epithelial Cells and Macrophages.
Journal: Front Microbiol | Authors: Cuicui Zhuang | Species: mouse | Application: WB - Activation of Sirtuin3 by 6,4'-Dihydroxy-7-methoxyflavanone Against Myoblasts Senescence by Attenuating D-Galactose-Induced Oxidative Stress and Inflammation.
Journal: Nutrients | Authors: Bingsi Li | Species: mouse | Application: WB,IF - L-Theanine Mitigates Acute Alcoholic Intestinal Injury by Activating the HIF-1 Signaling Pathway to Regulate the TLR4/NF-κB/HIF-1α Axis in Mice
Journal: Nutrients | Authors: Simin Tan | Species: mouse | Application: WB - Effect of Protein O-Mannosyltransferase (MSMEG_5447) on M. smegmatis and Its Survival in Macrophages.
Journal: Front Microbiol | Authors: Liqiu Jia | Species: human | Application: IF - Trans-Anethole Alleviates Subclinical Necro-Haemorrhagic Enteritis-Induced Intestinal Barrier Dysfunction and Intestinal Inflammation in Broilers.
Journal: Front Microbiol | Authors: Caiyun Yu | Species: chicken | Application: WB - Retinol binding protein 4 restricts PCV2 replication via selective autophagy degradation of viral ORF1 protein
Journal: Commun Biol | Authors: Qingbing Han | Species: pig | Application: WB - Poloxamer 407 and Hyaluronic Acid Thermosensitive Hydrogel-Encapsulated Ginsenoside Rg3 to Promote Skin Wound Healing
Journal: Front Bioeng Biotechnol | Authors: Xiaojuan Peng | Species: human | Application: IF - Piezo1 promotes vibration-induced vascular smooth muscle injury by regulating the NF-κB/p65 axis
Journal: Commun Biol | Authors: Yingshan Zeng | Species: rat | Application: IF - Sodium Butyrate Abrogates the Growth and Pathogenesis of Mycobacterium bovis via Regulation of Cathelicidin (LL37) Expression and NF-κB Signaling.
Journal: Front Microbiol | Authors: Kai Zhang | Species: human | Application: WB - Poloxamer 407 and Hyaluronic Acid Thermosensitive Hydrogel-Encapsulated Ginsenoside Rg3 to Promote Skin Wound Healing
Journal: Front Bioeng Biotechnol | Authors: Xiaojuan Peng | Species: human | Application: IF - EZH2 elicits CD8+ T-cell desert in esophageal squamous cell carcinoma via suppressing CXCL9 and dendritic cells
Journal: Commun Biol | Authors: Chun-Yan Zhu | Species: human | Application: WB - Dietary Fiber-Derived Butyrate Alleviates Piglet Weaning Stress by Modulating the TLR4/MyD88/NF-κB Pathway
Journal: Nutrients | Authors: Weikang Huangfu | Species: pig | Application: WB - Piezo1 promotes vibration-induced vascular smooth muscle injury by regulating the NF-κB/p65 axis
Journal: Commun Biol | Authors: Yingshan Zeng | Species: rat | Application: IF - NF-κB and poly (ADP-ribose) polymerase 1 form a positive-feedback loop that regulates DNA repair in acute myeloid leukemia cells.
Journal: Mol Cancer Res | Authors: Ding Li | Species: human | Application: WB - The antisense lncRNA of TAB2 that prevents oxidative stress to enhance the follicular growth in mammals
Journal: Commun Biol | Authors: Nian Li | Species: pig | Application: WB - Trans-Anethole Alleviates Subclinical Necro-Haemorrhagic Enteritis-Induced Intestinal Barrier Dysfunction and Intestinal Inflammation in Broilers.
Journal: Front Microbiol | Authors: Caiyun Yu | Species: chicken | Application: WB - Oligosaccharides from Polygonatum cyrtonema Hua ameliorate colitis-induced lung injury via modulation of the gut-lung axis through NF-κB and Nrf2 pathways.
Journal: Nat Prod Bioprospect | Authors: Jin Xu | Species: mouse,human | Application: WB - The Herb Pair Radix Rehmanniae and Cornus Officinalis Attenuated Testicular Damage in Mice With Diabetes Mellitus Through Butyric Acid/Glucagon-Like Peptide-1/Glucagon-Like Peptide-1 Receptor Pathway Mediated by Gut Microbiota.
Journal: Front Microbiol | Authors: Yuping Chen - Dietary Fiber-Derived Butyrate Alleviates Piglet Weaning Stress by Modulating the TLR4/MyD88/NF-κB Pathway
Journal: Nutrients | Authors: Weikang Huangfu | Species: pig | Application: WB - DCAAA mitigates neuroinflammation and microglial pyroptosis in spinal cord injury by inhibiting PI3K/AKT/NF-κB and NLRP3/caspase-1/GSDMD signaling
Journal: Eur J Pharmacol | Authors: Jimeng Gao | Species: rat,mouse | Application: WB - Glycyrrhetinic acid ameliorates cholestatic liver injury by inhibiting acHMGB1/TLR2-mediated crosstalk between hepatocytes and macrophages.
Journal: Eur J Pharmacol | Authors: Fengyi Weng - Remimazolam alleviates acute lung injury via translocator protein mediated inhibition of the NF-κB pathway.
Journal: Eur J Pharmacol | Authors: Ruohan Li | Species: mouse | Application: IHC,IF - Chondroprotective and antiarthritic effects of galangin in osteoarthritis: An in vitro and in vivo study.
Journal: Eur J Pharmacol | Authors: Xiaojian Huang | Species: rat | Application: WB,IF - Trilobatin alleviates non-alcoholic fatty liver disease in high-fat diet plus streptozotocin-induced diabetic mice by suppressing NLRP3 inflammasome activation
Journal: Eur J Pharmacol | Authors: Zhi-Tong Zhang | Species: mouse | Application: WB - Anti-inflammatory activity of coptisine free base in mice through inhibition of NF-κB and MAPK signaling pathways.
Journal: Eur J Pharmacol | Authors: Han-Bin Chen | Species: mouse | Application: WB - Anxiolytic effects of accelerated continuous theta burst stimulation on mice exposed to chronic restraint stress and the underlying mechanism involving gut microbiota
Journal: J Affect Disord | Authors: Yihan Wang | Species: mouse | Application: WB - Anxiolytic effects of accelerated continuous theta burst stimulation on mice exposed to chronic restraint stress and the underlying mechanism involving gut microbiota
Journal: J Affect Disord | Authors: Yihan Wang | Species: mouse | Application: WB - Oxidized DJ-1 activates the p-IKK/NF-κB/Beclin1 pathway by binding PTEN to induce autophagy and exacerbate myocardial ischemia-reperfusion injury
Journal: Eur J Pharmacol | Authors: Huiru Liu | Species: rat | Application: WB - G(1-5)-EM2, a multi-targeted agonist to opioid and growth hormone secretagogue receptors exhibited nontolerance forming antinociceptive effects in a mouse model of burn pain
Journal: Eur J Pharmacol | Authors: Songxia Cheng | Species: mouse | Application: WB - MSC-derived exosomes delivery of miR-714 protect mouse BV2 microglial cells from OGD/R injury by directly targeting ITGAM.
Journal: Eur J Pharmacol | Authors: Xiao-Xia Yang - Tubeimoside I protects against sepsis-induced cardiac dysfunction via SIRT3.
Journal: Eur J Pharmacol | Authors: Zhe Cheng | Species: rat,mouse | Application: WB - 18β-Glycyrrhetinic acid improves pulmonary hypertension by regulating the vascukar non-inflammatory molecule-1/L-arginine/nitric oxide signaling pathway
Journal: Eur J Pharmacol | Authors: Daliya Shanahati | Species: rat | Application: WB - Amygdalin attenuates post-ischemic neuroinflammation by targeting TLR4/NF-κB signaling and NLRP3 inflammasome in cerebral ischemia-reperfusion injury.
Journal: Eur J Pharmacol | Authors: Yan-Chen Wang | Species: rat | Application: WB - Protective Effects of Chitosan Oligosaccharide Against Lipopolysaccharide-Induced Inflammatory Response and Oxidative Stress in Bovine Mammary Epithelial Cells
Journal: Mar Drugs | Authors: Ziwei Lin - Azithromycin attenuates wheezing after pulmonary inflammation through inhibiting histone H3K27me3 hypermethylation mediated by EZH2
Journal: Clin Epigenetics | Authors: Shuqi Wu | Species: rat,human | Application: WB,IF - Piceatannol alleviates liver ischaemia/reperfusion injury by inhibiting TLR4/NF-κB/NLRP3 in hepatic macrophages
Journal: Eur J Pharmacol | Authors: Lei Yao | Species: mouse | Application: WB,IHC,IF - Effect of Nano-Gefitinib on Solid Ehrlich Carcinoma via Targeting EGFR, RIPK2 Pathways, and Macrophage Reprogramming.
Journal: Pharmaceuticals (Basel) | Authors: Neveen R. Ashoura | Species: mouse | Application: WB - 18β-Glycyrrhetinic acid improves pulmonary hypertension by regulating the vascukar non-inflammatory molecule-1/L-arginine/nitric oxide signaling pathway
Journal: Eur J Pharmacol | Authors: Daliya Shanahati | Species: rat | Application: WB - Mechanism of Lian-Huo-Hua-Zhuo Formula in Alleviating Gastric Mucosal Inflammation in a Mouse Model of Chronic Atrophic Gastritis by Inhibiting the IL-17 Signaling Pathway.
Journal: Pharmaceuticals (Basel) | Authors: Xiaoxuan Mo - Isoliquiritigenin Inhibits the Growth of Colorectal Cancer Cells through the ESR2/PI3K/AKT Signalling Pathway
Journal: Pharmaceuticals (Basel) | Authors: Fenglin Luo | Species: human | Application: WB,IF - Ginsenoside Rb3 modulates gut microbiota to alleviate cerebral inflammation and ferroptosis via the NLRP3/NF-κB/GPX4 pathway in rats with cerebral ischemia/reperfusion injury.
Journal: Eur J Pharmacol | Authors: Xueheng Xie | Species: rat | Application: WB - Remimazolam alleviates acute lung injury via translocator protein mediated inhibition of the NF-κB pathway.
Journal: Eur J Pharmacol | Authors: Ruohan Li | Species: mouse | Application: IHC,IF - Butyrolactone-I from Coral-Derived Fungus Aspergillus terreus Attenuates Neuro-Inflammatory Response via Suppression of NF-κB Pathway in BV-2 Cells.
Journal: Mar Drugs | Authors: Yuan Yuan Zhang | Species: mouse | Application: WB - Monotropein alleviates secondary liver injury in chronic colitis by regulating TLR4/NF-κB signaling and NLRP3 inflammasome.
Journal: Eur J Pharmacol | Authors: Yonger Chen | Species: mouse | Application: WB - Glycyrrhetinic acid ameliorates cholestatic liver injury by inhibiting acHMGB1/TLR2-mediated crosstalk between hepatocytes and macrophages.
Journal: Eur J Pharmacol | Authors: Fengyi Weng - Artemisia Extracts Suppress H1N1 Influenza A Virus Infection by Targeting Viral HA/NA Proteins and Modulating the TLR4/MyD88/NF-κB Signaling Axis.
Journal: Pharmaceuticals (Basel) | Authors: Zhongnan Hu | Species: canine | Application: WB - Role of Abca7-related microglial responses in linking type 2 diabetes mellitus to Alzheimer's Disease progression: Evidence from single-cell transcriptomic analysis and experimental validation in animal and cell models.
Journal: Eur J Pharmacol | Authors: Ming Cheng - Dipyridamole alleviates necroptosis and renal inflammation via cAMP/CREB signaling pathways in septic AKI mice.
Journal: Eur J Pharmacol | Authors: Jia Xing | Species: mouse | Application: WB - Liquiritigenin inhibits IL-1β-induced inflammation and cartilage matrix degradation in rat chondrocytes.
Journal: Eur J Pharmacol | Authors: Chang Tu | Species: rat | Application: WB,IF - Monotropein alleviates secondary liver injury in chronic colitis by regulating TLR4/NF-κB signaling and NLRP3 inflammasome.
Journal: Eur J Pharmacol | Authors: Yonger Chen | Species: mouse | Application: WB - MTMR14 depletion aggravates intrapulmonary inflammation and emphysema in experimental COPD through activating macrophage M1 polarization
Journal: Respir Res | Authors: Jiaheng Zhang | Species: mouse,human | Application: WB - Edaravone-dexborneol improves neurological function after cerebral ischemia-reperfusion injury by activating NRF2/p62 and suppressing NF-κB/NLRP3 signaling.
Journal: Eur J Pharmacol | Authors: Zezhou Xu - CUMS induces depressive-like behaviors and cognition impairment by activating the ERS-NLRP3 signaling pathway in mice
Journal: J Affect Disord | Authors: Ran Hao | Species: mouse | Application: IF - Protein Disulfide Isomerase A3, a Stress Response Gene, Is Associated with Cognitive Impairment in Schizophrenia and Linked to Inflammatory Activation.
Journal: Schizophr Bull | Authors: Xi Su | Species: mouse | Application: WB - Isosteviol ameliorates diabetic cardiomyopathy in rats by inhibiting ERK and NFκB signaling pathways.
Journal: J Endocrinol | Authors: Shenggao Tang | Species: rat | Application: WB - Scutellarin attenuates oxidative stress and neuroinflammation in cerebral ischemia/reperfusion injury through PI3K/Akt-mediated Nrf2 signaling pathways
Journal: Eur J Pharmacol | Authors: Xueheng Xie | Species: rat,mouse | Application: WB,IF - Protective Effects of Chitosan Oligosaccharide Against Lipopolysaccharide-Induced Inflammatory Response and Oxidative Stress in Bovine Mammary Epithelial Cells
Journal: Mar Drugs | Authors: Ziwei Lin - GLP-1RA partially alleviates obesity-induced reproductive dysfunction driven by the interplay mechanisms of inflammation and metabolic dysregulation via the SIRT-associated pathway.
Journal: Eur J Pharmacol | Authors: Tashinga Walter Matiki | Species: mouse | Application: WB - Erianin alleviates autoimmune myocarditis by suppressing the M1 polarization of macrophages via the NF-κB/NLRP3 signaling pathway
Journal: Eur J Pharmacol | Authors: Wenhu Liu | Species: mouse | Application: WB,IF - Protein Disulfide Isomerase A3, a Stress Response Gene, Is Associated with Cognitive Impairment in Schizophrenia and Linked to Inflammatory Activation.
Journal: Schizophr Bull | Authors: Xi Su | Species: mouse | Application: WB - Cinobufotalin ameliorates ulcerative colitis by modulating gut microbiota, restoring Th17/Treg balance, and inhibiting MAPK/NF-κB signaling pathways.
Journal: Eur J Pharmacol | Authors: Panfeng Feng | Species: mouse | Application: WB - The novel MyD88 inhibitor A5S ameliorates inflammation-driven diabetic cardiorenal complications.
Journal: Eur J Pharmacol | Authors: Yanan Liu | Species: mouse | Application: WB - Protein Disulfide Isomerase A3, a Stress Response Gene, Is Associated with Cognitive Impairment in Schizophrenia and Linked to Inflammatory Activation.
Journal: Schizophr Bull | Authors: Xi Su | Species: mouse | Application: WB - Role of Abca7-related microglial responses in linking type 2 diabetes mellitus to Alzheimer's Disease progression: Evidence from single-cell transcriptomic analysis and experimental validation in animal and cell models.
Journal: Eur J Pharmacol | Authors: Ming Cheng - Harnessing NLRX1: a new frontier in mitigating inflammation in pulmonary hypertension.
Journal: Respir Res | Authors: Yingchou Xiao | Species: mouse | Application: WB - Artemisia Extracts Suppress H1N1 Influenza A Virus Infection by Targeting Viral HA/NA Proteins and Modulating the TLR4/MyD88/NF-κB Signaling Axis.
Journal: Pharmaceuticals (Basel) | Authors: Zhongnan Hu | Species: canine | Application: WB - Azithromycin attenuates wheezing after pulmonary inflammation through inhibiting histone H3K27me3 hypermethylation mediated by EZH2
Journal: Clin Epigenetics | Authors: Shuqi Wu | Species: rat,human | Application: WB,IF - MSC-derived exosomes delivery of miR-714 protect mouse BV2 microglial cells from OGD/R injury by directly targeting ITGAM.
Journal: Eur J Pharmacol | Authors: Xiao-Xia Yang - Chromofungin, a chromogranin A-derived peptide, protects against sepsis-induced acute lung injury by inhibiting LBP/TLR4-dependent inflammatory signaling
Journal: Eur J Pharmacol | Authors: Wushuang Zhou | Species: mouse | Application: WB - Capsaicin attenuates DSS-induced IBD by suppressing macrophage M1 polarization via inhibition of the TRAF1/NF-κB pathway.
Journal: Eur J Pharmacol | Authors: Li Chen - Erianin alleviates autoimmune myocarditis by suppressing the M1 polarization of macrophages via the NF-κB/NLRP3 signaling pathway
Journal: Eur J Pharmacol | Authors: Wenhu Liu | Species: mouse | Application: WB,IF - Glycyrrhetinic acid ameliorates cholestatic liver injury by inhibiting acHMGB1/TLR2-mediated crosstalk between hepatocytes and macrophages.
Journal: Eur J Pharmacol | Authors: Fengyi Weng - Role of Abca7-related microglial responses in linking type 2 diabetes mellitus to Alzheimer's Disease progression: Evidence from single-cell transcriptomic analysis and experimental validation in animal and cell models.
Journal: Eur J Pharmacol | Authors: Ming Cheng - The facilitating effects of KRT80 on chemoresistance, lipogenesis, and invasion of esophageal cancer
Journal: Cancer Biol Ther | Authors: Wen-Jing Yun | Species: human | Application: WB - Capsaicin attenuates DSS-induced IBD by suppressing macrophage M1 polarization via inhibition of the TRAF1/NF-κB pathway.
Journal: Eur J Pharmacol | Authors: Li Chen - Protein Disulfide Isomerase A3, a Stress Response Gene, Is Associated with Cognitive Impairment in Schizophrenia and Linked to Inflammatory Activation.
Journal: Schizophr Bull | Authors: Xi Su | Species: mouse | Application: WB - The novel MyD88 inhibitor A5S ameliorates inflammation-driven diabetic cardiorenal complications.
Journal: Eur J Pharmacol | Authors: Yanan Liu | Species: mouse | Application: WB - ACOT8-mediated palmitate accumulation promotes M1 macrophage polarization in renal ischemia-reperfusion injury via activation of the cGAS-STING pathway.
Journal: Int Immunopharmacol | Authors: Haoxun Zhang | Species: mouse,human | Application: WB - Iso-seco-tanapartholide induces p62 covalent oligomerization to activate KEAP1-NRF2 redox pathway in rheumatoid arthritis
Journal: Int Immunopharmacol | Authors: Dongrong Zhu | Species: human | Application: WB,IF - Nppb contributes to Sepsis-Induced myocardial injury by regulating Senescence-Related genes
Journal: Int Immunopharmacol | Authors: Hang Yang | Application: WB - Protective effects of (R)-enantiomers but not (S)-enantiomers of β2-adrenergic receptor agonists against acute colitis: The role of β2AR.
Journal: Int Immunopharmacol | Authors: Liangjun Deng | Species: mouse | Application: WB - Nuciferine protects against lipopolysaccharide-induced endometritis via inhibiting ferroptosis and modulating AMPKα/mTOR/HIF-1α signaling axis
Journal: Int Immunopharmacol | Authors: Peng Jiang | Species: mouse | Application: WB - Identification of novel biomarker hsa_circ_0003914 for rheumatoid arthritis from plasma exosomes
Journal: Int Immunopharmacol | Authors: Qian He | Species: mouse,human | Application: WB - The Effects of an Osteoarthritic Joint Environment on ACL Damage and Degeneration: A Yucatan Miniature Pig Model
Journal: Biomolecules | Authors: Elias Schwartz | Species: pig | Application: IHC - High-fat diet led to testicular inflammation and ferroptosis via dysbiosis of gut microbes
Journal: Int Immunopharmacol | Authors: Zelin Zhang | Species: mouse | Application: WB - Uncovering the Potential Mechanisms of Ergothioneine in Neuroinflammation Through Network Pharmacology, Molecular Docking, Molecular Dynamics Simulation, and In Vitro Validation.
Journal: Int J Mol Sci | Authors: Deyou Cao | Species: mouse | Application: WB - Nppb contributes to Sepsis-Induced myocardial injury by regulating Senescence-Related genes
Journal: Int Immunopharmacol | Authors: Hang Yang | Application: WB - ACOD1 mediates Staphylococcus aureus-induced inflammatory response via the TLR4/NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Fan Dai | Species: mouse | Application: WB - SIRT3-AMPK signaling pathway as a protective target in endothelial dysfunction of early sepsis.
Journal: Int Immunopharmacol | Authors: Huilin Yu | Application: WB - Allosteric inhibition of the tyrosine phosphatase SHP2 enhances the anti-tumor immunity of interferon α through induction of caspase-1-mediated pyroptosis in renal cancer
Journal: Int Immunopharmacol | Authors: Ruiying Xi | Species: human | Application: WB - Azithromycin regulates Mettl3-mediated NF-κB pathway to enhance M2 polarization of RAW264.7 macrophages and attenuate LPS-triggered cytotoxicity of MLE-12 alveolar cells
Journal: Int Immunopharmacol | Authors: Shuna Xu | Species: mouse | Application: WB - Magnolol limits NFκB-dependent inflammation by targeting PPARγ relieving retinal ischemia/reperfusion injury
Journal: Int Immunopharmacol | Authors: Ning Wang | Species: mouse | Application: WB,IF - Long non-coding RNA NRIR inhibits osteogenesis in peri-implantitis by promoting NLRP3 inflammasome-mediated macrophage pyroptosis
Journal: Int Immunopharmacol | Authors: Lan Wang | Species: human | Application: WB,IF - Rice Protein Exerts Anti-Inflammatory Effect in Growing and Adult Rats via Suppressing NF-κB Pathway.
Journal: Int J Mol Sci | Authors: Zhengxuan Wang | Species: rat | Application: WB - pNaktide mitigates inflammation-induced neuronal damage and behavioral deficits through the oxidative stress pathway
Journal: Int Immunopharmacol | Authors: Qinglan Zong | Species: mouse | Application: WB - Berberine alleviates LPS-induced inflammatory response by targeted activation of NR1D1 in bovine endometrial epithelial cells.
Journal: Int Immunopharmacol | Authors: Wanghao Yang | Species: mouse,bovine | Application: WB - The Effects of an Osteoarthritic Joint Environment on ACL Damage and Degeneration: A Yucatan Miniature Pig Model
Journal: Biomolecules | Authors: Elias Schwartz | Species: pig | Application: IHC - MRG15 aggravates sepsis-related liver injury by promoting PCSK9 synthesis and secretion.
Journal: Int Immunopharmacol | Authors: Boyuan Gu | Species: mouse | Application: WB - Ursolic Acid Alleviates Neuroinflammation after Intracerebral Hemorrhage by Mediating Microglial Pyroptosis via the NF-κB/NLRP3/GSDMD Pathway
Journal: Int J Mol Sci | Authors: Pan Lei | Species: rat,mouse | Application: WB - https://www.ncbi.nlm.nih.gov/pubmed/39983421?dopt=Abstract
Application: WB - Loganin promotes diabetic wound healing and inhibits NLRP3 inflammasomes in diabetic mice via IL17/NF-κB signaling.
Journal: Int Immunopharmacol | Authors: Jian Zhou | Species: mouse | Application: WB - ADAMTS19 Suppresses Cell Migration and Invasion by Targeting S100A16 via the NF-κB Pathway in Human Gastric Cancer.
Journal: Biomolecules | Authors: Yingming Jiang | Species: Human | Application: IF - Selective Targeting of Class I HDAC Reduces Microglial Inflammation in the Entorhinal Cortex of Young APP/PS1 Mice
Journal: Int J Mol Sci | Authors: Chunyang Wang | Species: mouse | Application: WB - Naringin mitigates myocardial strain and the inflammatory response in sepsis-induced myocardial dysfunction through regulation of PI3K/AKT/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Li-Juan Sun | Species: rat | Application: WB,IHC - Naringin mitigates myocardial strain and the inflammatory response in sepsis-induced myocardial dysfunction through regulation of PI3K/AKT/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Li-Juan Sun | Species: rat | Application: WB,IHC - Pyroptosis of chondrocytes activated by synovial inflammation accelerates TMJ osteoarthritis cartilage degeneration via ROS/NLRP3 signaling
Journal: Int Immunopharmacol | Authors: Xin Liu | Species: mouse,human | Application: IHC,IF - USP7 inhibition promotes wound healing by suppressing M1 macrophage polarization via NF-κB/MAPK signaling pathway.
Journal: Int Immunopharmacol | Authors: Shami Aihemaiti | Species: mouse | Application: WB - Therapeutic effects of recombinant human brain natriuretic peptide on sepsis-associated encephalopathy in mice.
Journal: Int Immunopharmacol | Authors: Nan Li | Species: mouse | Application: WB - GDF11 protects against sepsis-induced myocardial injury and cardiac dysfunction by targeting the Nrf2 signaling pathway-dependent ferroptosis.
Journal: Int Immunopharmacol | Authors: Haibo Zhang - Knockdown of DNMT1 Induces SLCO3A1 to Promote Follicular Growth by Enhancing the Proliferation of Granulosa Cells in Mammals
Journal: Int J Mol Sci | Authors: Shuo Li | Species: pig | Application: WB - Corynebacterium striatum drives neutrophilic asthma via IL-17 signaling activation
Journal: Int Immunopharmacol | Authors: Xin Yu - Integrative Transcriptomic and Metabolomic Analysis Reveals That Acanthopanax senticosus Fruit Ameliorates Cisplatin-Induced Acute Kidney Injury by Suppressing the NF-κB/PI3K-AKT Pathway via UGT1A1 Regulation.
Journal: Int J Mol Sci | Authors: Liu Han | Species: mouse | Application: WB - Inhibiting fibroblast activation protein mitigates aging-related periodontitis by blocking nuclear factor kappa B-mediated osteoclastogenesis.
Journal: Int Immunopharmacol | Authors: Yuezhang Sun | Species: mouse | Application: WB - Marein ameliorates the progression of osteoarthritis: An in vitro and in vivo studies
Journal: Int Immunopharmacol | Authors: Li Yin | Species: mouse | Application: WB - Asiatic acid from Potentilla chinensis alleviates non-alcoholic fatty liver by regulating endoplasmic reticulum stress and lipid metabolism.
Journal: Int Immunopharmacol | Authors: Dandan Wang | Species: human | Application: WB - IL-38 suppresses macrophage M1 polarization to ameliorate synovial inflammation in the TMJ via GLUT-1 inhibition
Journal: Int Immunopharmacol | Authors: Ping Luo | Species: mouse | Application: IF - Antioxidation, anti-inflammation and anti-apoptosis by paeonol in LPS/d-GalN-induced acute liver failure in mice.
Journal: Int Immunopharmacol | Authors: Xiaobao Gong | Species: mouse | Application: WB - Effects of Nitric Oxide on Bladder Detrusor Overactivity through the NRF2 and HIF-1α Pathways: A Rat Model Induced by Metabolic Syndrome and Ovarian Hormone Deficiency
Journal: Int J Mol Sci | Authors: Hung-Yu Lin | Application: WB - A caspase-dependent pathway is involved in Wnt/β-catenin signaling promoted apoptosis in Bacillus Calmette-Guerin infected RAW264.7 macrophages.
Journal: Int J Mol Sci | Authors: Xiaoling Wu | Species: mouse | Application: WB - Alleviation of inflammation in paraventricular nucleus and sympathetic outflow by melatonin efficiently repairs endplate porosities and attenuates spinal hyperalgesia
Journal: Int Immunopharmacol | Authors: Miaoheng Yan | Species: mouse | Application: WB,IF - Targeting inflammation and necroptosis in diabetic kidney disease: A novel approach via PPARα modulation
Journal: Int Immunopharmacol | Authors: Yu Wang | Species: human | Application: WB - Grossamide attenuates inflammation by balancing macrophage polarization through metabolic reprogramming of macrophages in mice
Journal: Int Immunopharmacol | Authors: Wenlong Zhao | Species: mouse | Application: WB - Grossamide attenuates inflammation by balancing macrophage polarization through metabolic reprogramming of macrophages in mice
Journal: Int Immunopharmacol | Authors: Wenlong Zhao | Species: mouse | Application: WB - CP-25 improves nephropathy in collagen-induced arthritis rats by inhibiting the renal inflammatory response.
Journal: Int Immunopharmacol | Authors: Chun Wang | Species: rat | Application: WB - Oxyresveratrol prevents lipopolysaccharide/d-galactosamine-induced acute liver injury in mice.
Journal: Int Immunopharmacol | Authors: Ya-Nan Jia | Species: mouse | Application: WB - Arginyl-fructosyl-glucose (AFG), a major Maillard reaction product of red ginseng, improved kidney and pancreatic injury in vitro and in vivo in type 2 diabetes mellitus
Journal: Int Immunopharmacol | Authors: Ivan Steve Nguepi Tsopmejio - Targeting inflammation and necroptosis in diabetic kidney disease: A novel approach via PPARα modulation
Journal: Int Immunopharmacol | Authors: Yu Wang | Species: human | Application: WB - Nuciferine Inhibits Oral Squamous Cell Carcinoma Partially through Suppressing the STAT3 Signaling Pathway
Journal: Int J Mol Sci | Authors: Ji-Rong Xie | Species: human | Application: WB - Hydrogen combined with tetrandrine attenuates silica-induced pulmonary fibrosis via suppressing NF-kappaB/NLRP3 signaling pathway-mediated epithelial mesenchymal transition and inflammation
Journal: Int Immunopharmacol | Authors: Juan Li | Species: rat | Application: WB,IHC - ACOT8-mediated palmitate accumulation promotes M1 macrophage polarization in renal ischemia-reperfusion injury via activation of the cGAS-STING pathway.
Journal: Int Immunopharmacol | Authors: Haoxun Zhang | Species: mouse,human | Application: WB - Methyl Gallate Alleviates Acute Ulcerative Colitis by Modulating Gut Microbiota and Inhibiting TLR4/NF-κB Pathway
Journal: Int J Mol Sci | Authors: Ping Zhou | Species: mouse | Application: WB - The Effects of an Osteoarthritic Joint Environment on ACL Damage and Degeneration: A Yucatan Miniature Pig Model
Journal: Biomolecules | Authors: Elias Schwartz | Species: pig | Application: IHC - Limonin ameliorates ulcerative colitis by regulating STAT3/miR-214 signaling pathway.
Journal: Int Immunopharmacol | Authors: Shijia Liu | Species: human | Application: WB - Hsa_circRNA_103124 upregulation in Crohn's disease promoted macrophage M1 polarization to maintain an inflammatory microenvironment via activation of the AKT2 and TLR4/NF-κB pathways
Journal: Int Immunopharmacol | Authors: Juan Yin | Species: human | Application: WB - Environmental pollutants, bisphenol A and di(2-ethylhexyl) phthalate, induce spontaneous dermatitis-like skin lesions via TLR4/NF-κB/ferroptosis.
Journal: Int Immunopharmacol | Authors: Jialiang Luo | Species: mouse,human | Application: WB - Gstk1 confers cardioprotection in sepsis by regulating mitochondrial function and inhibiting cGAS/STING-dependent inflammation and pyroptosis.
Journal: Int Immunopharmacol | Authors: Min Gao | Species: rat,mouse | Application: WB - Alleviation of inflammation in paraventricular nucleus and sympathetic outflow by melatonin efficiently repairs endplate porosities and attenuates spinal hyperalgesia
Journal: Int Immunopharmacol | Authors: Miaoheng Yan | Species: mouse | Application: WB,IF - Protective effect of combination of anakinra and MCC950 against acute lung injury is achieved through suppression of the NF-κB-mediated-MAPK and NLRP3-caspase pathways.
Journal: Int Immunopharmacol | Authors: Xiuhong Wang | Species: mouse | Application: WB - α-Cyperone protects dopaminergic neurons and inhibits neuroinflammation in LPS-induced Parkinson's disease rat model via activating Nrf2/HO-1 and suppressing NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Bingxu Huang | Species: mouse | Application: WB - Oxyresveratrol prevents lipopolysaccharide/d-galactosamine-induced acute liver injury in mice.
Journal: Int Immunopharmacol | Authors: Ya-Nan Jia | Species: mouse | Application: WB - Hepatoprotective effects and structure-activity relationship of five flavonoids against lipopolysaccharide/d-galactosamine induced acute liver failure in mice.
Journal: Int Immunopharmacol | Authors: Yutong He | Species: mouse | Application: WB - IL-38 suppresses macrophage M1 polarization to ameliorate synovial inflammation in the TMJ via GLUT-1 inhibition
Journal: Int Immunopharmacol | Authors: Ping Luo | Species: mouse | Application: IF - Senescence marker protein 30 (SMP30) protects against high glucose-induced apoptosis, oxidative stress and inflammatory response in retinal ganglion cells by enhancing Nrf2 activation via regulation of Akt/GSK-3β pathway
Journal: Int Immunopharmacol | Authors: Le Zhang | Species: mouse | Application: WB - Macrophage migration inhibitory factor (MIF) inhibitor iSO-1 promotes staphylococcal protein A-induced osteogenic differentiation by inhibiting NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Xiangwen Shi | Species: rat,human | Application: WB - Eplerenone inhibits UUO-induced lymphangiogenesis and cardiac fibrosis by attenuating inflammatory injury.
Journal: Int Immunopharmacol | Authors: Gege Chen | Species: rat | Application: WB - Methyl Gallate Alleviates Acute Ulcerative Colitis by Modulating Gut Microbiota and Inhibiting TLR4/NF-κB Pathway
Journal: Int J Mol Sci | Authors: Ping Zhou | Species: mouse | Application: WB - Discovery of Phenolic Glycoside from Hyssopus cuspidatus Attenuates LPS-Induced Inflammatory Responses by Inhibition of iNOS and COX-2 Expression through Suppression of NF-κB Activation.
Journal: Int J Mol Sci | Authors: Xingyu Liu | Species: mouse | Application: WB,IF - ADAMTS19 Suppresses Cell Migration and Invasion by Targeting S100A16 via the NF-κB Pathway in Human Gastric Cancer.
Journal: Biomolecules | Authors: Yingming Jiang | Species: Human | Application: IF - Nuciferine protects against lipopolysaccharide-induced endometritis via inhibiting ferroptosis and modulating AMPKα/mTOR/HIF-1α signaling axis
Journal: Int Immunopharmacol | Authors: Peng Jiang | Species: mouse | Application: WB - STING knockdown blocks disease progression and inflammation in mice with alcoholic liver disease by relieving pyroptosis via suppressing NLRP3.
Journal: Int Immunopharmacol | Authors: Yuxuan Song | Species: mouse | Application: WB - The Effects of an Osteoarthritic Joint Environment on ACL Damage and Degeneration: A Yucatan Miniature Pig Model
Journal: Biomolecules | Authors: Elias Schwartz | Species: pig | Application: IHC - Corynebacterium striatum drives neutrophilic asthma via IL-17 signaling activation
Journal: Int Immunopharmacol | Authors: Xin Yu - Magnolol limits NFκB-dependent inflammation by targeting PPARγ relieving retinal ischemia/reperfusion injury
Journal: Int Immunopharmacol | Authors: Ning Wang | Species: mouse | Application: WB,IF - Preventive effects of matrine on LPS-induced inflammation in RAW 264.7 cells and intestinal damage in mice through the TLR4/NF-κB/MAPK pathway
Journal: Int Immunopharmacol | Authors: Ningning Mao | Application: WB,IF - Osteostatin Mitigates Gouty Arthritis through the Inhibition of Caspase-1 Activation and Upregulation of Nrf2 Expression
Journal: Int J Mol Sci | Authors: Laura Catalán | Species: Mouse | Application: WB - Limonin ameliorates dextran sulfate sodium-induced chronic colitis in mice by inhibiting PERK-ATF4-CHOP pathway of ER stress and NF-κB signaling.
Journal: Int Immunopharmacol | Authors: Changqin Song | Species: mouse | Application: WB,IHC - Allosteric inhibition of the tyrosine phosphatase SHP2 enhances the anti-tumor immunity of interferon α through induction of caspase-1-mediated pyroptosis in renal cancer
Journal: Int Immunopharmacol | Authors: Ruiying Xi | Species: human | Application: WB - Fennel essential oil and its nanoemulsion modulate macrophage-mediated inflammatory responses and promote pressure ulcer healing.
Journal: Int Immunopharmacol | Authors: Zhiling Luo | Species: mouse | Application: WB - Loganin promotes diabetic wound healing and inhibits NLRP3 inflammasomes in diabetic mice via IL17/NF-κB signaling.
Journal: Int Immunopharmacol | Authors: Jian Zhou | Species: mouse | Application: WB - The p65-LOC727924-miR-26a/KPNA3-p65 regulatory loop mediates vasoactive intestinal peptide effects on osteoarthritis chondrocytes
Journal: Int Immunopharmacol | Authors: Yusheng Li | Species: mouse | Application: WB - Protective effects of the total saponins from Dioscorea nipponica Makino against carbon tetrachloride-induced liver injury in mice through suppression of apoptosis and inflammation.
Journal: Int Immunopharmacol | Authors: Hao Yu | Species: mouse | Application: WB - ADAMTS19 Suppresses Cell Migration and Invasion by Targeting S100A16 via the NF-κB Pathway in Human Gastric Cancer.
Journal: Biomolecules | Authors: Yingming Jiang | Species: Human | Application: IF - Rhodococcus equi-Derived Extracellular Vesicles Promoting Inflammatory Response in Macrophage through TLR2-NF-κB/MAPK Pathways
Journal: Int J Mol Sci | Authors: Zhaokun Xu | Application: WB - Nuciferine protects against lipopolysaccharide-induced endometritis via inhibiting ferroptosis and modulating AMPKα/mTOR/HIF-1α signaling axis
Journal: Int Immunopharmacol | Authors: Peng Jiang | Species: mouse | Application: WB - Anticancer effect of SZC015 on lung cancer cells through ROS-dependent apoptosis and autophagy induction mechanisms in vitro.
Journal: Int Immunopharmacol | Authors: Bin Sun | Species: human | Application: WB - Berberine Inhibits MDA-MB-231 Cells as an Agonist of G Protein-Coupled Estrogen Receptor 1.
Journal: Int J Mol Sci | Authors: Miaomiao Qi | Species: human | Application: WB - Aspirin Inhibits the Inflammatory Response of Protease-Activated Receptor 1 in Pregnancy Neutrophils: Implications for Treating Women with Preeclampsia
Journal: Int J Mol Sci | Authors: Scott W. Walsh | Species: human | Application: IF - LINC01393, a Novel Long Non-Coding RNA, Promotes the Cell Proliferation, Migration and Invasion through MiR-128-3p/NUSAP1 Axis in Glioblastoma
Journal: Int J Mol Sci | Authors: Deheng Li | Species: human | Application: WB - Antioxidation, anti-inflammation and anti-apoptosis by paeonol in LPS/d-GalN-induced acute liver failure in mice.
Journal: Int Immunopharmacol | Authors: Xiaobao Gong | Species: mouse | Application: WB - Transcriptional Regulation of RIP2 Gene by NFIB Is Associated with Cellular Immune and Inflammatory Response to APEC Infection.
Journal: Int J Mol Sci | Authors: Hongyan Sun | Species: chicken | Application: WB - Protective effects of (R)-enantiomers but not (S)-enantiomers of β2-adrenergic receptor agonists against acute colitis: The role of β2AR.
Journal: Int Immunopharmacol | Authors: Liangjun Deng | Species: mouse | Application: WB - Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models.
Journal: Int Immunopharmacol | Authors: Meng Wang | Species: mouse | Application: WB - Iso-seco-tanapartholide induces p62 covalent oligomerization to activate KEAP1-NRF2 redox pathway in rheumatoid arthritis
Journal: Int Immunopharmacol | Authors: Dongrong Zhu | Species: human | Application: WB,IF - Hepatoprotective effect of quercetin against LPS/d-GalN induced acute liver injury in mice by inhibiting the IKK/NF-κB and MAPK signal pathways.
Journal: Int Immunopharmacol | Authors: Zhixin Peng | Species: mouse | Application: WB,IHC - Therapeutic Effect of Platelet-Rich Plasma Improves Bladder Overactivity in the Pathogenesis of Ketamine-Induced Ulcerative Cystitis in a Rat Model.
Journal: Int J Mol Sci | Authors: Kuang-Shun Chueh | Species: rat | Application: WB - Toralactone alleviates cisplatin-induced acute kidney injury by modulating the gut microbiota-renal axis
Journal: Int Immunopharmacol | Authors: Yan Tian | Species: mouse | Application: WB - Combinatory FK506 and Minocycline Treatment Alleviates Prion-Induced Neurodegenerative Events via Caspase-Mediated MAPK-NRF2 Pathway.
Journal: Int J Mol Sci | Authors: Syed Zahid Ali Shah | Species: hamster | Application: WB - Exenatide improves hypogonadism and attenuates inflammation in diabetic mice by modulating gut microbiota
Journal: Int Immunopharmacol | Authors: Yuping Chen | Species: mouse | Application: WB - Therapeutic Effect of Platelet-Rich Plasma Improves Bladder Overactivity in the Pathogenesis of Ketamine-Induced Ulcerative Cystitis in a Rat Model.
Journal: Int J Mol Sci | Authors: Kuang-Shun Chueh | Species: rat | Application: WB - Indole-3-Propionic Acid, a Functional Metabolite of Clostridium sporogenes, Promotes Muscle Tissue Development and Reduces Muscle Cell Inflammation.
Journal: Int J Mol Sci | Authors: Lei Du | Species: mouse | Application: WB - Methyl Gallate Alleviates Acute Ulcerative Colitis by Modulating Gut Microbiota and Inhibiting TLR4/NF-κB Pathway
Journal: Int J Mol Sci | Authors: Ping Zhou | Species: mouse | Application: WB - Selective Targeting of Class I HDAC Reduces Microglial Inflammation in the Entorhinal Cortex of Young APP/PS1 Mice
Journal: Int J Mol Sci | Authors: Chunyang Wang | Species: mouse | Application: WB - ADAMTS19 Suppresses Cell Migration and Invasion by Targeting S100A16 via the NF-κB Pathway in Human Gastric Cancer.
Journal: Biomolecules | Authors: Yingming Jiang | Species: Human | Application: IF - TRIM38 protects chondrocytes from IL-1β-induced apoptosis and degeneration via negatively modulating nuclear factor (NF)-κB signaling.
Journal: Int Immunopharmacol | Authors: Shouye Hu | Species: mouse | Application: WB - Hepatoprotective effects and structure-activity relationship of five flavonoids against lipopolysaccharide/d-galactosamine induced acute liver failure in mice.
Journal: Int Immunopharmacol | Authors: Yutong He | Species: mouse | Application: WB - Sasanquasaponin from Camellia oleifera Abel Exerts an Anti-Inflammatory Effect in RAW 264.7 Cells via Inhibition of the NF-κB/MAPK Signaling Pathways
Journal: Int J Mol Sci | Authors: Yaxin Zhao | Species: mouse | Application: WB - MLN4924 alleviates autoimmune myocarditis by promoting Act1 degradation and blocking Act1-mediated mRNA stability
Journal: Int Immunopharmacol | Authors: Zuli Jiang | Species: rat | Application: WB - Exenatide improves hypogonadism and attenuates inflammation in diabetic mice by modulating gut microbiota
Journal: Int Immunopharmacol | Authors: Yuping Chen | Species: mouse | Application: WB - Astragaloside IV improves the isoproterenol-induced vascular dysfunction via attenuating eNOS uncoupling-mediated oxidative stress and inhibiting ROS-NF-κB pathways.
Journal: Int Immunopharmacol | Authors: Chonghua Xu | Species: rat | Application: WB - Fennel essential oil and its nanoemulsion modulate macrophage-mediated inflammatory responses and promote pressure ulcer healing.
Journal: Int Immunopharmacol | Authors: Zhiling Luo | Species: mouse | Application: WB - A Regulatory Loop Involving miR-200c and NF-κB Modulates Mortalin Expression and Increases Cisplatin Sensitivity in an Ovarian Cancer Cell Line Model
Journal: Int J Mol Sci | Authors: Xin Huang | Species: human | Application: WB,IF - Bixin protects mice against bronchial asthma though modulating PI3K/Akt pathway.
Journal: Int Immunopharmacol | Authors: Yingjie Zhu | Species: mouse | Application: WB,IHC - Sorcin Inhibits Mitochondrial Apoptosis by Interacting with STAT3 via NF-κB Pathway
Journal: Int J Mol Sci | Authors: Yizi Li | Species: mouse,human | Application: WB,IHC - miR-9 targeting RUNX1 improves LPS-induced alveolar hypercoagulation and fibrinolysis inhibition through NF-κB inactivation in ARDS
Journal: Int Immunopharmacol | Authors: Chuan Xiao | Species: rat | Application: WB - Ghrelin Attenuates Liver Fibrosis through Regulation of TGF-β1 Expression and Autophagy.
Journal: Int J Mol Sci | Authors: Yuqing Mao | Species: mouse | Application: WB,IHC - Exenatide improves hypogonadism and attenuates inflammation in diabetic mice by modulating gut microbiota
Journal: Int Immunopharmacol | Authors: Yuping Chen | Species: mouse | Application: WB - The effect of Astragaloside IV on ethanol-induced gastric mucosal injury in rats: Involvement of inflammation.
Journal: Int Immunopharmacol | Authors: Shumin Qin | Species: rat | Application: WB - Integrative Transcriptomic and Metabolomic Analysis Reveals That Acanthopanax senticosus Fruit Ameliorates Cisplatin-Induced Acute Kidney Injury by Suppressing the NF-κB/PI3K-AKT Pathway via UGT1A1 Regulation.
Journal: Int J Mol Sci | Authors: Liu Han | Species: mouse | Application: WB - A caspase-dependent pathway is involved in Wnt/β-catenin signaling promoted apoptosis in Bacillus Calmette-Guerin infected RAW264.7 macrophages.
Journal: Int J Mol Sci | Authors: Xiaoling Wu | Species: mouse | Application: WB - IL-38 suppresses macrophage M1 polarization to ameliorate synovial inflammation in the TMJ via GLUT-1 inhibition
Journal: Int Immunopharmacol | Authors: Ping Luo | Species: mouse | Application: IF - Hydrogen combined with tetrandrine attenuates silica-induced pulmonary fibrosis via suppressing NF-kappaB/NLRP3 signaling pathway-mediated epithelial mesenchymal transition and inflammation
Journal: Int Immunopharmacol | Authors: Juan Li | Species: rat | Application: WB,IHC - Bixin protects mice against bronchial asthma though modulating PI3K/Akt pathway.
Journal: Int Immunopharmacol | Authors: Yingjie Zhu | Species: mouse | Application: WB,IHC - Fraxin inhibits ovariectomized-induced bone loss and osteoclastogenesis by suppressing ROS activity
Journal: Int Immunopharmacol | Authors: Han Zhou | Species: mouse | Application: IF - Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models.
Journal: Int Immunopharmacol | Authors: Meng Wang | Species: mouse | Application: WB - Dioscin reduces lipopolysaccharide-induced inflammatory liver injury via regulating TLR4/MyD88 signal pathway.
Journal: Int Immunopharmacol | Authors: Hong Yao | Species: mouse | Application: WB - Berberine Inhibits MDA-MB-231 Cells as an Agonist of G Protein-Coupled Estrogen Receptor 1.
Journal: Int J Mol Sci | Authors: Miaomiao Qi | Species: human | Application: WB - Colorectal cancer cells establish metabolic reprogramming with cancer-associated fibroblasts (CAFs) through lactate shuttle to enhance invasion, migration, and angiogenesis
Journal: Int Immunopharmacol | Authors: Xingchen Wang | Species: human | Application: WB - Inhibition of TNFAIP1 ameliorates the oxidative stress and inflammatory injury in myocardial ischemia/reperfusion injury through modulation of Akt/GSK-3β/Nrf2 pathway.
Journal: Int Immunopharmacol | Authors: Liang Wen | Species: rat | Application: WB - Ghrelin Attenuates Liver Fibrosis through Regulation of TGF-β1 Expression and Autophagy.
Journal: Int J Mol Sci | Authors: Yuqing Mao | Species: mouse | Application: WB,IHC - miR-9 targeting RUNX1 improves LPS-induced alveolar hypercoagulation and fibrinolysis inhibition through NF-κB inactivation in ARDS
Journal: Int Immunopharmacol | Authors: Chuan Xiao | Species: rat | Application: WB - Naringin mitigates myocardial strain and the inflammatory response in sepsis-induced myocardial dysfunction through regulation of PI3K/AKT/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Li-Juan Sun | Species: rat | Application: WB,IHC - Baicalein attenuates the neuroinflammation in LPS-activated BV-2 microglial cells through suppression of pro-inflammatory cytokines, COX2/NF-κB expressions and regulation of metabolic abnormality.
Journal: Int Immunopharmacol | Authors: Jiao-Jiao Yan | Species: mouse | Application: WB - Ghrelin Attenuates Liver Fibrosis through Regulation of TGF-β1 Expression and Autophagy.
Journal: Int J Mol Sci | Authors: Yuqing Mao | Species: mouse | Application: WB,IHC - Arginyl-fructosyl-glucose (AFG), a major Maillard reaction product of red ginseng, improved kidney and pancreatic injury in vitro and in vivo in type 2 diabetes mellitus
Journal: Int Immunopharmacol | Authors: Ivan Steve Nguepi Tsopmejio - Kongensin A targeting PI3K attenuates inflammation-induced osteoarthritis by modulating macrophage polarization and alleviating inflammatory signaling
Journal: Int Immunopharmacol | Authors: Yuhui Guo | Species: mouse | Application: WB - Meloxicam inhibited oxidative stress and inflammatory response of LPS-stimulated bovine endometrial epithelial cells through Nrf2 and NF-κB pathways
Journal: Int Immunopharmacol | Authors: Luying Cui | Species: human | Application: WB,IF - Bixin protects mice against bronchial asthma though modulating PI3K/Akt pathway.
Journal: Int Immunopharmacol | Authors: Yingjie Zhu | Species: mouse | Application: WB,IHC - Inflachromene inhibits intimal hyperplasia through the HMGB1/2- regulated TLR4-NF-κB pathway
Journal: Int Immunopharmacol | Authors: Shuai Teng | Species: human | Application: WB,IF - Protective effects of dioscin against systemic inflammatory response syndromevia adjusting TLR2/MyD88/NF‑κb signal pathway.
Journal: Int Immunopharmacol | Authors: Xuerong Zhao | Species: mouse | Application: WB - Arginyl-fructosyl-glucose (AFG), a major Maillard reaction product of red ginseng, improved kidney and pancreatic injury in vitro and in vivo in type 2 diabetes mellitus
Journal: Int Immunopharmacol | Authors: Ivan Steve Nguepi Tsopmejio - Corynebacterium striatum drives neutrophilic asthma via IL-17 signaling activation
Journal: Int Immunopharmacol | Authors: Xin Yu - Inhibition of Hepatocyte Apoptosis: An Important Mechanism of Corn Peptides Attenuating Liver Injury Induced by Ethanol.
Journal: Int J Mol Sci | Authors: Zhili Ma | Species: mouse | Application: WB - Gut microbiota contributes to obstructive sleep apnea-induced hypertension by gut-heart axis in mice
Journal: Int Immunopharmacol | Authors: Xiaotong Zhang | Application: WB - Berberine Inhibits MDA-MB-231 Cells as an Agonist of G Protein-Coupled Estrogen Receptor 1.
Journal: Int J Mol Sci | Authors: Miaomiao Qi | Species: human | Application: WB - Fennel essential oil and its nanoemulsion modulate macrophage-mediated inflammatory responses and promote pressure ulcer healing.
Journal: Int Immunopharmacol | Authors: Zhiling Luo | Species: mouse | Application: WB - Fraxin inhibits ovariectomized-induced bone loss and osteoclastogenesis by suppressing ROS activity
Journal: Int Immunopharmacol | Authors: Han Zhou | Species: mouse | Application: IF - Diallyl trisulfide inhibits naphthalene-induced oxidative injury and the production of inflammatory responses in A549 cells and mice.
Journal: Int Immunopharmacol | Authors: Fang Zhang | Species: human | Application: WB - Rice Protein Exerts Anti-Inflammatory Effect in Growing and Adult Rats via Suppressing NF-κB Pathway.
Journal: Int J Mol Sci | Authors: Zhengxuan Wang | Species: rat | Application: WB - A Regulatory Loop Involving miR-200c and NF-κB Modulates Mortalin Expression and Increases Cisplatin Sensitivity in an Ovarian Cancer Cell Line Model
Journal: Int J Mol Sci | Authors: Xin Huang | Species: human | Application: WB,IF - Colorectal cancer cells establish metabolic reprogramming with cancer-associated fibroblasts (CAFs) through lactate shuttle to enhance invasion, migration, and angiogenesis
Journal: Int Immunopharmacol | Authors: Xingchen Wang | Species: human | Application: WB - Quercetin reduces Streptococcus suis virulence by inhibiting suilysin activity and inflammation.
Journal: Int Immunopharmacol | Authors: Gen Li | Species: mouse | Application: WB - Geraniol-mediated osteoarthritis improvement by down-regulating PI3K/Akt/NF-κB and MAPK signals: In vivo and in vitro studies.
Journal: Int Immunopharmacol | Authors: Yifan Wu | Species: mouse | Application: WB,IF - Adipose-derived stem cell exosomes loaded with icariin attenuated M1 polarization of macrophages via inhibiting the TLR4/Myd88/NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Qiqi Yan | Species: mouse,human | Application: WB - Berberine alleviates LPS-induced inflammatory response by targeted activation of NR1D1 in bovine endometrial epithelial cells.
Journal: Int Immunopharmacol | Authors: Wanghao Yang | Species: mouse,bovine | Application: WB - Inhibition of Hepatocyte Apoptosis: An Important Mechanism of Corn Peptides Attenuating Liver Injury Induced by Ethanol.
Journal: Int J Mol Sci | Authors: Zhili Ma | Species: mouse | Application: WB - Macrophage migration inhibitory factor (MIF) inhibitor iSO-1 promotes staphylococcal protein A-induced osteogenic differentiation by inhibiting NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Xiangwen Shi | Species: rat,human | Application: WB - Trim27 aggravates airway inflammation and oxidative stress in asthmatic mice via potentiating the NLRP3 inflammasome
Journal: Int Immunopharmacol | Authors: Kaimeng Liu | Species: mouse | Application: WB - Indirubin protects chondrocytes and alleviates OA by inhibiting the MAPK and NF-κB pathways
Journal: Int Immunopharmacol | Authors: Xiaolin Wang | Species: mouse | Application: WB - GABA-mediated activated microglia induce neuroinflammation in the hippocampus of mice following cold exposure through the NLRP3 inflammasome and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Limin Lang | Species: mouse | Application: WB - A Flavonoid Glycoside Compound from Siraitia grosvenorii with Anti-Inflammatory and Hepatoprotective Effects In Vitro
Journal: Biomolecules | Authors: Juanjiang Wu | Species: mouse | Application: WB - Identification of novel biomarker hsa_circ_0003914 for rheumatoid arthritis from plasma exosomes
Journal: Int Immunopharmacol | Authors: Qian He | Species: mouse,human | Application: WB - Aspirin Inhibits the Inflammatory Response of Protease-Activated Receptor 1 in Pregnancy Neutrophils: Implications for Treating Women with Preeclampsia
Journal: Int J Mol Sci | Authors: Scott W. Walsh | Species: human | Application: IF - Hydrogen combined with tetrandrine attenuates silica-induced pulmonary fibrosis via suppressing NF-kappaB/NLRP3 signaling pathway-mediated epithelial mesenchymal transition and inflammation
Journal: Int Immunopharmacol | Authors: Juan Li | Species: rat | Application: WB,IHC - SIRT3-AMPK signaling pathway as a protective target in endothelial dysfunction of early sepsis.
Journal: Int Immunopharmacol | Authors: Huilin Yu | Application: WB - An Experimental Study Reveals the Protective Effect of Autophagy against Realgar-Induced Liver Injury via Suppressing ROS-Mediated NLRP3 Inflammasome Pathway.
Journal: Int J Mol Sci | Authors: Jing Yang | Species: mouse | Application: WB - Long non-coding RNA NRIR inhibits osteogenesis in peri-implantitis by promoting NLRP3 inflammasome-mediated macrophage pyroptosis
Journal: Int Immunopharmacol | Authors: Lan Wang | Species: human | Application: WB,IF - Therapeutic Effect of Platelet-Rich Plasma Improves Bladder Overactivity in the Pathogenesis of Ketamine-Induced Ulcerative Cystitis in a Rat Model.
Journal: Int J Mol Sci | Authors: Kuang-Shun Chueh | Species: rat | Application: WB - Targeting inflammation and necroptosis in diabetic kidney disease: A novel approach via PPARα modulation
Journal: Int Immunopharmacol | Authors: Yu Wang | Species: human | Application: WB - SAL protects endothelial cells from H(2)O(2)-induced endothelial dysfunction: Regulation of inflammation and autophagy by EZH2.
Journal: Int Immunopharmacol | Authors: Li Sun | Species: human | Application: WB - Protease-activated receptor 2 (PAR-2) antagonist AZ3451 as a novel therapeutic agent for osteoarthritis.
Journal: Aging (Albany NY) | Authors: Xiaojian Huang | Species: rat | Application: WB - The Interleukin-33/ST2 axis promotes glioma mesenchymal transition, stemness and TMZ resistance via JNK activation.
Journal: Aging (Albany NY) | Authors: Lin Lin | Species: human | Application: WB - Decreased RIPK1 expression in chondrocytes alleviates osteoarthritis via the TRIF/MyD88-RIPK1-TRAF2 negative feedback loop.
Journal: Aging (Albany NY) | Authors: Shuang Liang | Species: mouse | Application: WB - Runx2 Suppresses Astrocyte Activation and Astroglial Scar Formation After Spinal Cord Injury in Mice.
Journal: Mol Neurobiol | Authors: Leilei Lu | Species: mouse | Application: WB,IF - Microbiota-driven therapeutic efficacy of Hyperoside in ulcerative colitis and associated anxiety.
Journal: Front Cell Infect Microbiol | Authors: Li Yin | Species: mouse | Application: WB - Protective effect of flavonoid-rich extract from Rosa laevigata Michx on cerebral ischemia-reperfusion injury through suppression of apoptosis and inflammation.
Journal: Neurochem Int | Authors: Zhang Shuai S | Species: rat | Application: WB - Runx2 Suppresses Astrocyte Activation and Astroglial Scar Formation After Spinal Cord Injury in Mice.
Journal: Mol Neurobiol | Authors: Leilei Lu | Species: mouse | Application: WB,IF - Glucocorticoid-Induced Leucine Zipper Protects the Retina From Light-Induced Retinal Degeneration by Inducing Bcl-xL in Rats.
Journal: Invest Ophthalmol Vis Sci | Authors: Ruiping Gu | Species: rat | Application: WB - Microbiota-driven therapeutic efficacy of Hyperoside in ulcerative colitis and associated anxiety.
Journal: Front Cell Infect Microbiol | Authors: Li Yin | Species: mouse | Application: WB - Glucocorticoid-Induced Leucine Zipper Suppresses ICAM-1 and MCP-1 Expression by Dephosphorylation of NF-κB p65 in Retinal Endothelial Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Ruiping Gu | Species: rat | Application: WB - Cepharanthine alleviated chronic prostatitis/chronic pelvic pain syndrome by activating Nrf2 and inhibiting the NF-κB pathway.
Journal: Biol Direct | Authors: Hang Zhang | Species: mouse,human | Application: WB,IHC,IF - Cordycepin Mitigates Sepsis-Associated Encephalopathy by Promoting Microglial M2 Polarization via the IL-17a/IL-17RA/NF-κB Axis.
Journal: Mol Neurobiol | Authors: Ying Yuan | Species: mouse | Application: WB - HDAC6 inhibition attenuates early brain injury after experimental subarachnoid hemorrhage and suppresses neuroinflammatory responses.
Journal: Neurochem Int | Authors: Rui Zhang | Species: mouse | Application: IHC - Glucocorticoid-Induced Leucine Zipper Suppresses ICAM-1 and MCP-1 Expression by Dephosphorylation of NF-κB p65 in Retinal Endothelial Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Ruiping Gu | Species: rat | Application: WB - Microbiota-driven therapeutic efficacy of Hyperoside in ulcerative colitis and associated anxiety.
Journal: Front Cell Infect Microbiol | Authors: Li Yin | Species: mouse | Application: WB - Isoquercetin Ameliorates Cerebral Impairment in Focal Ischemia Through Anti-Oxidative, Anti-Inflammatory, and Anti-Apoptotic Effects in Primary Culture of Rat Hippocampal Neurons and Hippocampal CA1 Region of Rats.
Journal: Mol Neurobiol | Authors: Cai-Ping Wang | Species: rat | Application: WB - Protective effect of flavonoid-rich extract from Rosa laevigata Michx on cerebral ischemia-reperfusion injury through suppression of apoptosis and inflammation.
Journal: Neurochem Int | Authors: Zhang Shuai S | Species: rat | Application: WB - Fusobacterium necrophorum Promotes Apoptosis and Inflammatory Cytokine Production Through the Activation of NF-κB and Death Receptor Signaling Pathways
Journal: Front Cell Infect Microbiol | Authors: Feng-Feng Wang | Species: sheep | Application: WB - A Novel Effect of Id2 in Microglia TNFα Regulation
Journal: Mol Neurobiol | Authors: Wenhui Wang | Species: mouse | Application: CoIP - Runx2 Suppresses Astrocyte Activation and Astroglial Scar Formation After Spinal Cord Injury in Mice.
Journal: Mol Neurobiol | Authors: Leilei Lu | Species: mouse | Application: WB,IF - Isoquercetin Ameliorates Cerebral Impairment in Focal Ischemia Through Anti-Oxidative, Anti-Inflammatory, and Anti-Apoptotic Effects in Primary Culture of Rat Hippocampal Neurons and Hippocampal CA1 Region of Rats.
Journal: Mol Neurobiol | Authors: Cai-Ping Wang | Species: rat | Application: WB - Glucocorticoid-Induced Leucine Zipper Suppresses ICAM-1 and MCP-1 Expression by Dephosphorylation of NF-κB p65 in Retinal Endothelial Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Ruiping Gu | Species: rat | Application: WB - MALT1 Knockdown Alleviates Multiorgan Injury and Inflammation Through Inhibiting TAK1/NF-κB Signaling Pathway-Mediated T-Helper 1 and 17 Differentiations in LPS-induced Inflammation.
Journal: Inflammation | Authors: Qinghe Huang | Species: mouse | Application: WB - Chemical Fingerprint Analysis and Ultra-Performance Liquid Chromatography Quadrupole Time-of-Flight Mass Spectrometry-Based Metabolomics Study of the Protective Effect of Buxue Yimu Granule in Medical-Induced Incomplete Abortion Rats.
Journal: Front Pharmacol | Authors: Yan Zhang | Application: IHC - Ulinastatin Alleviates Rhabdomyolysis-Induced Acute Kidney Injury by Suppressing Inflammation and Apoptosis via Inhibiting TLR4/NF-κB Signaling Pathway.
Journal: Inflammation | Authors: Jinxiang Wang | Species: rat | Application: WB - Thymoquinone and aerobic exercise mitigate HFpEF-induced cardiac injury via Apaf1/Cycs axis regulation.
Journal: Front Pharmacol | Authors: Zuowei Pei | Species: mouse | Application: WB - Astragalin Inhibits the Proliferation and Migration of Human Colon Cancer HCT116 Cells by Regulating the NF-κB Signaling Pathway.
Journal: Front Pharmacol | Authors: Min Yang | Species: human | Application: WB,IHC - Inhibiting sEH suppresses NF-κB p65 signaling and reduces CXCL10 expression as a potential therapeutic target in HT
Journal: J Clin Endocrinol Metab | Authors: Jing Feng | Species: rat,human | Application: WB,IF - Curcumol alleviates cardiac and cerebral injury caused by encephalomyocarditis virus (EMCV) in Kunming mice via suppressing NF-κB/NLRP3 inflammasome pathway.
Journal: Front Pharmacol | Authors: Panpan Sun | Species: mouse | Application: WB - Umbilical cord stem cells therapy against bacterial pneumonia based on zebrafish pneumonia model
Journal: Front Pharmacol | Authors: Xueli Chen | Species: zebrafish | Application: WB - Chrysin sensitizes glioblastoma cells and spheroids to temozolomide treatment by reducing EMT and stemness phenotypes, as well as targeting multidrug resistance proteins
Journal: Front Pharmacol | Authors: Yunus Aksüt - Anti-inflammation Effects of Oxysophoridine on Cerebral Ischemia-Reperfusion Injury in Mice.
Journal: Inflammation | Authors: Yong-Sheng Wang | Species: mouse | Application: WB,IHC - Investigating the therapeutic mechanism of Puerarin in vascular dementia: an integrated approach combining network pharmacology and experimental validation.
Journal: Front Pharmacol | Authors: Hongmei Tang - Chemical Fingerprint Analysis and Ultra-Performance Liquid Chromatography Quadrupole Time-of-Flight Mass Spectrometry-Based Metabolomics Study of the Protective Effect of Buxue Yimu Granule in Medical-Induced Incomplete Abortion Rats.
Journal: Front Pharmacol | Authors: Yan Zhang | Application: IHC - Kaempferol From Penthorum chinense Pursh Attenuates Hepatic Ischemia/Reperfusion Injury by Suppressing Oxidative Stress and Inflammation Through Activation of the Nrf2/HO-1 Signaling Pathway.
Journal: Front Pharmacol | Authors: Yifan Chen | Species: mouse | Application: WB - Protective effects of Scutellariae Radix Carbonisata-derived carbon dots on blood-heat and hemorrhage rats
Journal: Front Pharmacol | Authors: Meiling Zhang | Species: rat,mouse | Application: WB - KAE ameliorates LPS-mediated acute lung injury by inhibiting PANoptosis through the intracellular DNA-cGAS-STING axis
Journal: Front Pharmacol | Authors: Yonghu Chen | Species: mouse | Application: WB - Protective Effects of Dioscin against Lipopolysaccharide-Induced Acute Lung Injury through Inhibition of Oxidative Stress and Inflammation.
Journal: Front Pharmacol | Authors: Hong Yao | Species: human | Application: WB - Glycyrrhizic Acid Alleviates Lipopolysaccharide (LPS)-Induced Acute Lung Injury by Regulating Angiotensin-Converting Enzyme-2 (ACE2) and Caveolin-1 Signaling Pathway.
Journal: Inflammation | Authors: Yangye Chen | Species: human | Application: WB,IF - PCSK9 Promotes Endothelial Dysfunction During Sepsis Via the TLR4/MyD88/NF-κB and NLRP3 Pathways
Journal: Inflammation | Authors: Longxiang Huang | Species: mouse,human | Application: WB - Chlorogenic Acid Improves NAFLD by Regulating gut Microbiota and GLP-1.
Journal: Front Pharmacol | Authors: Ameng Shi | Species: mouse | Application: WB - Schisandrin A Inhibits the IL-1β-Induced Inflammation and Cartilage Degradation via Suppression of MAPK and NF-κB Signal Pathways in Rat Chondrocytes.
Journal: Front Pharmacol | Authors: Chang Tu | Species: rat | Application: WB,IF - NOD3 Reduces Sepsis-Induced Acute Lung Injury by Regulating the Activation of NLRP3 Inflammasome and the Polarization of Alveolar Macrophages
Journal: Inflammation | Authors: Yue Zhao | Species: mouse | Application: WB - BCI Suppresses RANKL-Mediated Osteoclastogenesis and Alleviates Ovariectomy-Induced Bone Loss.
Journal: Front Pharmacol | Authors: Chenhui Cai | Species: mouse | Application: WB,IF - Wuji Wan ameliorates ulcerative colitis by restoring impaired membrane transport.
Journal: Front Pharmacol | Authors: Jianyu Zhang | Species: mouse | Application: WB - Isodon lophanthoides alleviates liver fibrosis via modulation of purine metabolism and NF-κB signaling pathway: insights from multi-omics analysis
Journal: Front Pharmacol | Authors: Kuikui Chen - Glycitin Suppresses Cartilage Destruction of Osteoarthritis in Mice.
Journal: Inflammation | Authors: Wenhan Wang | Species: mouse | Application: WB,IHC - Kaempferol From Penthorum chinense Pursh Attenuates Hepatic Ischemia/Reperfusion Injury by Suppressing Oxidative Stress and Inflammation Through Activation of the Nrf2/HO-1 Signaling Pathway.
Journal: Front Pharmacol | Authors: Yifan Chen | Species: mouse | Application: WB - Pulsed electromagnetic field ameliorates the progression of osteoarthritis via the Sirt1/NF-κB pathway
Journal: Arthritis Res Ther | Authors: Siqi Zhou | Species: human | Application: WB - Research on the metabolic regulation mechanism of Yangyin Qingfei decoction plus in severe pneumonia caused by Mycoplasma pneumoniae in mice
Journal: Front Pharmacol | Authors: Tianyu Zhang | Species: mouse | Application: WB - The mechanism of Vicenin-2 in ameliorating skin photoaging: involvement of m6A-modified macrophage polarization.
Journal: Front Pharmacol | Authors: Yan Zhou | Species: mouse | Application: WB - Anti-inflammation Effects of Oxysophoridine on Cerebral Ischemia-Reperfusion Injury in Mice.
Journal: Inflammation | Authors: Yong-Sheng Wang | Species: mouse | Application: WB,IHC - Improvement of vaginal probiotics Lactobacillus crispatus on intrauterine adhesion in mice model and in clinical practice
Journal: BMC Microbiol | Authors: Fei Wu | Species: mouse | Application: WB - Curcumol alleviates cardiac and cerebral injury caused by encephalomyocarditis virus (EMCV) in Kunming mice via suppressing NF-κB/NLRP3 inflammasome pathway.
Journal: Front Pharmacol | Authors: Panpan Sun | Species: mouse | Application: WB - Glycyrrhizic Acid Alleviates Lipopolysaccharide (LPS)-Induced Acute Lung Injury by Regulating Angiotensin-Converting Enzyme-2 (ACE2) and Caveolin-1 Signaling Pathway.
Journal: Inflammation | Authors: Yangye Chen | Species: human | Application: WB,IF - Effects of Poria cocos extract on metabolic dysfunction-associated fatty liver disease via the FXR/PPARα-SREBPs pathway
Journal: Front Pharmacol | Authors: Jinbiao He | Species: rat | Application: WB - Chitosan/Sodium Alginate/Velvet Antler Blood Peptides Hydrogel Promoted Wound Healing by Regulating PI3K/AKT/mTOR and SIRT1/NF-κB Pathways.
Journal: Front Pharmacol | Authors: Mingqian Hao - Necrostatin-1 Attenuates Trauma-Induced Mouse Osteoarthritis and IL-1β Induced Apoptosis via HMGB1/TLR4/SDF-1 in Primary Mouse Chondrocytes.
Journal: Front Pharmacol | Authors: Shuang Liang | Species: mouse | Application: WB - Astragalin Inhibits the Proliferation and Migration of Human Colon Cancer HCT116 Cells by Regulating the NF-κB Signaling Pathway.
Journal: Front Pharmacol | Authors: Min Yang | Species: human | Application: WB,IHC - Trimetazidine Attenuates Exhaustive Exercise-Induced Myocardial Injury in Rats via Regulation of the Nrf2/NF-κB Signaling Pathway.
Journal: Front Pharmacol | Authors: Hongming Zhang | Species: rat | Application: WB - MALT1 Knockdown Alleviates Multiorgan Injury and Inflammation Through Inhibiting TAK1/NF-κB Signaling Pathway-Mediated T-Helper 1 and 17 Differentiations in LPS-induced Inflammation.
Journal: Inflammation | Authors: Qinghe Huang | Species: mouse | Application: WB - Multi-omics reveals the protective mechanisms of Gastrodia elata ethyl acetate extract in vascular dementia.
Journal: Front Pharmacol | Authors: Jie Tao | Species: rat,mouse | Application: WB - Isodon lophanthoides alleviates liver fibrosis via modulation of purine metabolism and NF-κB signaling pathway: insights from multi-omics analysis
Journal: Front Pharmacol | Authors: Kuikui Chen - Research on the metabolic regulation mechanism of Yangyin Qingfei decoction plus in severe pneumonia caused by Mycoplasma pneumoniae in mice
Journal: Front Pharmacol | Authors: Tianyu Zhang | Species: mouse | Application: WB - Glycitin Suppresses Cartilage Destruction of Osteoarthritis in Mice.
Journal: Inflammation | Authors: Wenhan Wang | Species: mouse | Application: WB,IHC - Ulinastatin Alleviates Rhabdomyolysis-Induced Acute Kidney Injury by Suppressing Inflammation and Apoptosis via Inhibiting TLR4/NF-κB Signaling Pathway.
Journal: Inflammation | Authors: Jinxiang Wang | Species: rat | Application: WB - Donor-Matched Peripheral Blood-Derived Mesenchymal Stem Cells Combined With Platelet-Rich Plasma Synergistically Ameliorate Surgery-Induced Osteoarthritis in Rabbits: An In Vitro and In Vivo Study
Journal: Am J Sports Med | Authors: Kaibo Zhang | Species: rabbit | Application: WB - Research on the metabolic regulation mechanism of Yangyin Qingfei decoction plus in severe pneumonia caused by Mycoplasma pneumoniae in mice
Journal: Front Pharmacol | Authors: Tianyu Zhang | Species: mouse | Application: WB - Resatorvid alleviates experimental inflammatory TMJOA by restraining chondrocyte pyroptosis and synovial inflammation
Journal: Arthritis Res Ther | Authors: Xin Liu | Species: mouse | Application: WB,IF - Polydatin combined with hawthorn flavonoids alleviate high fat diet induced atherosclerosis by remodeling the gut microbiota and glycolipid metabolism
Journal: Front Pharmacol | Authors: Dan Li | Species: mouse | Application: WB,IHC - Swine acute diarrhea syndrome coronavirus nsp5 induces apoptosis by targeting GATA zinc finger domain-containing protein 2A (GATAD2A/p66α).
Journal: mBio | Authors: Haixin Huang - Resatorvid alleviates experimental inflammatory TMJOA by restraining chondrocyte pyroptosis and synovial inflammation
Journal: Arthritis Res Ther | Authors: Xin Liu | Species: mouse | Application: WB,IF - MALT1 Knockdown Alleviates Multiorgan Injury and Inflammation Through Inhibiting TAK1/NF-κB Signaling Pathway-Mediated T-Helper 1 and 17 Differentiations in LPS-induced Inflammation.
Journal: Inflammation | Authors: Qinghe Huang | Species: mouse | Application: WB - Interleukin-17A Plays the Same Role on Mice Acute Lung Injury Respectively Induced by Lipopolysaccharide and Paraquat.
Journal: Inflammation | Authors: Hong-Wei Song | Species: mouse | Application: IHC - Polydatin combined with hawthorn flavonoids alleviate high fat diet induced atherosclerosis by remodeling the gut microbiota and glycolipid metabolism
Journal: Front Pharmacol | Authors: Dan Li | Species: mouse | Application: WB,IHC - Anthraquinone Emodin Inhibits Tumor Necrosis Factor Alpha-Induced Calcification of Human Aortic Valve Interstitial Cells via the NF-κB Pathway.
Journal: Front Pharmacol | Authors: Kang Xu | Species: human | Application: WB - USP43 Inhibits Intestinal Inflammation via TRAF4-mediated NF-κB Signaling.
Journal: Inflammation | Authors: Li Zhou | Species: mouse | Application: WB,IF - Functional Role of SUV39H1 in Human Renal Tubular Epithelial Cells Under High-glucose Ambiance.
Journal: Inflammation | Authors: Jiayi Wang | Species: human | Application: WB - MALT1 Knockdown Alleviates Multiorgan Injury and Inflammation Through Inhibiting TAK1/NF-κB Signaling Pathway-Mediated T-Helper 1 and 17 Differentiations in LPS-induced Inflammation.
Journal: Inflammation | Authors: Qinghe Huang | Species: mouse | Application: WB - Salvianolic Acid B Ameliorates Cerebral Ischemia/Reperfusion Injury Through Inhibiting TLR4/MyD88 Signaling Pathway.
Journal: Inflammation | Authors: Yujue Wang | Species: human | Application: WB - Chitosan/Sodium Alginate/Velvet Antler Blood Peptides Hydrogel Promoted Wound Healing by Regulating PI3K/AKT/mTOR and SIRT1/NF-κB Pathways.
Journal: Front Pharmacol | Authors: Mingqian Hao - Bergenin, Acting as an Agonist of PPARγ, Ameliorates Experimental Colitis in Mice through Improving Expression of SIRT1, and Therefore Inhibiting NF-κB-Mediated Macrophage Activation.
Journal: Front Pharmacol | Authors: Kai Wang | Species: mouse | Application: WB,IP,IF - Glycitin Suppresses Cartilage Destruction of Osteoarthritis in Mice.
Journal: Inflammation | Authors: Wenhan Wang | Species: mouse | Application: WB,IHC - Zhuifeng tougu capsules inhibit the TLR4/MyD88/NF-κB signaling pathway and alleviate knee osteoarthritis: In vitro and in vivo experiments
Journal: Front Pharmacol | Authors: Xiaotong Xu | Application: IF - Glycitin Suppresses Cartilage Destruction of Osteoarthritis in Mice.
Journal: Inflammation | Authors: Wenhan Wang | Species: mouse | Application: WB,IHC - Astragaloside IV Improves High-Fat Diet-Induced Hepatic Steatosis in Nonalcoholic Fatty Liver Disease Rats by Regulating Inflammatory Factors Level via TLR4/NF-κB Signaling Pathway.
Journal: Front Pharmacol | Authors: Ying-Li Liu | Application: WB - p-Coumaric Acid Attenuates IL-1β-Induced Inflammatory Responses and Cellular Senescence in Rat Chondrocytes.
Journal: Inflammation | Authors: Xiaojian Huang | Species: rat | Application: WB - Effects of Poria cocos extract on metabolic dysfunction-associated fatty liver disease via the FXR/PPARα-SREBPs pathway
Journal: Front Pharmacol | Authors: Jinbiao He | Species: rat | Application: WB - Aucubin Attenuates Liver Ischemia-Reperfusion Injury by Inhibiting the HMGB1/TLR-4/NF-κB Signaling Pathway, Oxidative Stress, and Apoptosis.
Journal: Front Pharmacol | Authors: Shilong Zhang | Species: rat | Application: WB - Astragalin Inhibits the Proliferation and Migration of Human Colon Cancer HCT116 Cells by Regulating the NF-κB Signaling Pathway.
Journal: Front Pharmacol | Authors: Min Yang | Species: human | Application: WB,IHC - BCI Suppresses RANKL-Mediated Osteoclastogenesis and Alleviates Ovariectomy-Induced Bone Loss.
Journal: Front Pharmacol | Authors: Chenhui Cai | Species: mouse | Application: WB,IF - Improvement of vaginal probiotics Lactobacillus crispatus on intrauterine adhesion in mice model and in clinical practice
Journal: BMC Microbiol | Authors: Fei Wu | Species: mouse | Application: WB - Enhancing Fatty Acids Oxidation via L-Carnitine Attenuates Obesity-Related Atrial Fibrillation and Structural Remodeling by Activating AMPK Signaling and Alleviating Cardiac Lipotoxicity.
Journal: Front Pharmacol | Authors: Yudi Zhang | Species: rat | Application: WB - Yin-Chen-Hao Tang Attenuates Severe Acute Pancreatitis in Rat: An Experimental Verification of In silico Network Target Prediction.
Journal: Front Pharmacol | Authors: Hong Xiang | Species: human | Application: WB - Gardenia Decoction Prevent Intestinal Mucosal Injury by Inhibiting Pro-inflammatory Cytokines and NF-κB Signaling.
Journal: Front Pharmacol | Authors: Yizhe Cui | Species: mouse | Application: WB - Kaempferol From Penthorum chinense Pursh Attenuates Hepatic Ischemia/Reperfusion Injury by Suppressing Oxidative Stress and Inflammation Through Activation of the Nrf2/HO-1 Signaling Pathway.
Journal: Front Pharmacol | Authors: Yifan Chen | Species: mouse | Application: WB - Novel recombinant protein flagellin A N/C attenuates experimental autoimmune encephalomyelitis by suppressing the ROS/NF-κB/NLRP3 signaling pathway
Journal: Front Pharmacol | Authors: Li Li | Species: mouse | Application: WB,IF - Anti-inflammation Effects of Oxysophoridine on Cerebral Ischemia-Reperfusion Injury in Mice.
Journal: Inflammation | Authors: Yong-Sheng Wang | Species: mouse | Application: WB,IHC - Aucubin Attenuates Liver Ischemia-Reperfusion Injury by Inhibiting the HMGB1/TLR-4/NF-κB Signaling Pathway, Oxidative Stress, and Apoptosis.
Journal: Front Pharmacol | Authors: Shilong Zhang | Species: rat | Application: WB - Protective Effects of Costunolide Against D-Galactosamine and Lipopolysaccharide-Induced Acute Liver Injury in Mice.
Journal: Front Pharmacol | Authors: Jingxin Mao | Species: mouse | Application: WB - Donor-Matched Peripheral Blood-Derived Mesenchymal Stem Cells Combined With Platelet-Rich Plasma Synergistically Ameliorate Surgery-Induced Osteoarthritis in Rabbits: An In Vitro and In Vivo Study
Journal: Am J Sports Med | Authors: Kaibo Zhang | Species: rabbit | Application: WB - Impact of Resolvin D1 on the inflammatory phenotype of periodontal ligament cell response to hypoxia
Journal: J Periodontal Res | Authors: Jiazheng Cai | Species: human | Application: WB - Swine acute diarrhea syndrome coronavirus nsp5 induces apoptosis by targeting GATA zinc finger domain-containing protein 2A (GATAD2A/p66α).
Journal: mBio | Authors: Haixin Huang - Aconiti lateralis radix praeparata total alkaloids exert anti-RA effects by regulating NF-κB and JAK/STAT signaling pathways and promoting apoptosis
Journal: Front Pharmacol | Authors: Yeke Wu | Species: human | Application: WB,IF - Pharmacological evaluation of physcion as a TRPV1 inhibitor with multimodal analgesic efficacy in experimental pain models
Journal: Biol Res | Authors: Hanbin Chen | Species: mouse | Application: WB - Sodium Butyrate Ameliorates Intestinal Injury and Improves Survival in a Rat Model of Cecal Ligation and Puncture-Induced Sepsis.
Journal: Inflammation | Authors: Jiahong Fu | Species: rat | Application: WB,IF - Investigating the therapeutic mechanism of Puerarin in vascular dementia: an integrated approach combining network pharmacology and experimental validation.
Journal: Front Pharmacol | Authors: Hongmei Tang - Pharmacological evaluation of physcion as a TRPV1 inhibitor with multimodal analgesic efficacy in experimental pain models
Journal: Biol Res | Authors: Hanbin Chen | Species: mouse | Application: WB - Sodium Butyrate Ameliorates Intestinal Injury and Improves Survival in a Rat Model of Cecal Ligation and Puncture-Induced Sepsis.
Journal: Inflammation | Authors: Jiahong Fu | Species: rat | Application: WB,IF - Swine acute diarrhea syndrome coronavirus nsp5 induces apoptosis by targeting GATA zinc finger domain-containing protein 2A (GATAD2A/p66α).
Journal: mBio | Authors: Haixin Huang - Necrostatin-1 Attenuates Trauma-Induced Mouse Osteoarthritis and IL-1β Induced Apoptosis via HMGB1/TLR4/SDF-1 in Primary Mouse Chondrocytes.
Journal: Front Pharmacol | Authors: Shuang Liang | Species: mouse | Application: WB - Aconiti lateralis radix praeparata total alkaloids exert anti-RA effects by regulating NF-κB and JAK/STAT signaling pathways and promoting apoptosis
Journal: Front Pharmacol | Authors: Yeke Wu | Species: human | Application: WB,IF - Protective Effects of Costunolide Against D-Galactosamine and Lipopolysaccharide-Induced Acute Liver Injury in Mice.
Journal: Front Pharmacol | Authors: Jingxin Mao | Species: mouse | Application: WB - Calcitriol Ameliorates AngiotensinII-Induced Renal Injury Partly via Upregulating A20.
Journal: Inflammation | Authors: Hongfei Zhao | Species: rat | Application: WB,IF - Phosphatidylethanolamine-binding protein 4 deficiency exacerbates carbon tetrachloride-induced liver fibrosis by regulating the NF-κB signaling pathway
Journal: Front Pharmacol | Authors: Qianqian Luo | Species: mouse | Application: WB - Functional Role of SUV39H1 in Human Renal Tubular Epithelial Cells Under High-glucose Ambiance.
Journal: Inflammation | Authors: Jiayi Wang | Species: human | Application: WB - Salvianolic Acid B Ameliorates Cerebral Ischemia/Reperfusion Injury Through Inhibiting TLR4/MyD88 Signaling Pathway.
Journal: Inflammation | Authors: Yujue Wang | Species: human | Application: WB - CAPE-pNO2ameliorated diabetic nephropathy through regulating the Akt/NF-κB/ iNOS pathway in STZ-induced diabetic mice.
Journal: Oncotarget | Authors: Xiaoling Wang | Species: mouse | Application: WB - Impact of prenatal cold stress on placental physiology, inflammatory response, and apoptosis in rats.
Journal: Oncotarget | Authors: Shuai Lian | Species: rat | Application: WB - An Inhibitor of NF-κB and an Agonist of AMPK: Network Prediction and Multi-Omics Integration to Derive Signaling Pathways for Acteoside Against Alzheimer's Disease.
Journal: Front Cell Dev Biol | Authors: Ying-Qi Li | Species: mouse | Application: WB - The Therapeutic Potential of Lactobacillus crispatus for Chronic Endometritis: A Comprehensive Clinical Trial and Experimental Investigation
Journal: Probiotics Antimicrob Proteins | Authors: Xia He | Species: mouse | Application: WB - Deficiency of CD147 Attenuated Non-alcoholic Steatohepatitis Progression in an NLRP3-Dependent Manner.
Journal: Front Cell Dev Biol | Authors: Tian Zhang | Species: human | Application: WB - Electroacupuncture Reduces Oocyte Number and Maintains Vascular Barrier Against Ovarian Hyperstimulation Syndrome by Regulating CD200.
Journal: Front Cell Dev Biol | Authors: Li Chen | Species: human | Application: WB - A multi-mics exploration of programmed cell death in non-obstructive azoospermia: identifying TLR4 as a central regulator and therapeutic target.
Journal: Front Cell Dev Biol | Authors: Qi Yu | Species: mouse | Application: WB - Blockade of Macrophage CD147 Protects Against Foam Cell Formation in Atherosclerosis.
Journal: Front Cell Dev Biol | Authors: Jian-Jun Lv - Electroacupuncture Reduces Oocyte Number and Maintains Vascular Barrier Against Ovarian Hyperstimulation Syndrome by Regulating CD200.
Journal: Front Cell Dev Biol | Authors: Li Chen | Species: human | Application: WB - Deficiency of CD147 Attenuated Non-alcoholic Steatohepatitis Progression in an NLRP3-Dependent Manner.
Journal: Front Cell Dev Biol | Authors: Tian Zhang | Species: human | Application: WB - An Inhibitor of NF-κB and an Agonist of AMPK: Network Prediction and Multi-Omics Integration to Derive Signaling Pathways for Acteoside Against Alzheimer's Disease.
Journal: Front Cell Dev Biol | Authors: Ying-Qi Li | Species: mouse | Application: WB - 6-Gingerol exerts a protective effect against hypoxic injury through the p38/Nrf2/HO-1 and p38/NF-κB pathway in H9c2 cells.
Journal: J Nutr Biochem | Authors: Xue Han | Application: WB - Loganin reduces diabetic kidney injury by inhibiting the activation of NLRP3 inflammasome-mediated pyroptosis
Journal: Chem Biol Interact | Authors: Xiangri Kong | Species: human | Application: IHC - HMGB1 knock-down promoting tumor cells viability and arrest pro-apoptotic proteins via Stat3/NFκB in HepG2 cells.
Journal: Biofactors | Authors: Salah Alduais | Species: human | Application: WB - Chronic ethanol exposure induces neuroinflammation in H4 cells through TLR3 / NF-κB pathway and anxiety-like behavior in male C57BL/6 mice.
Journal: Toxicology | Authors: Xiaolong Wang | Species: mouse | Application: WB - Protective effects of neohesperidin dihydrochalcone against carbon tetrachloride-induced oxidative damage in vivo and in vitro.
Journal: Chem Biol Interact | Authors: Lihua Hu | Species: mouse | Application: WB - Soyasaponin Bb/Gelatin-Methacryloyl Hydrogel for Cartilage Inflammation Inhibition
Journal: ACS Omega | Authors: Yuhan Jiang | Species: human | Application: WB - HMGB1 knock-down promoting tumor cells viability and arrest pro-apoptotic proteins via Stat3/NFκB in HepG2 cells.
Journal: Biofactors | Authors: Salah Alduais | Species: human | Application: WB - Mitochondrial reactive oxygen species initiate gasdermin D-mediated pyroptosis and contribute to paraquat-induced nephrotoxicity
Journal: Chem Biol Interact | Authors: Kaiyuan Chen | Species: human | Application: WB - Dioscin attenuates gastric ischemia/reperfusion injury through the down-regulation of PKC/ERK1/2 signaling via PKCα and PKCβ2 inhibition.
Journal: Chem Biol Interact | Authors: Yupeng Hu | Species: human | Application: WB - Protective role of forsythoside B in Kawasaki disease-induced cardiac injury: Inhibition of pyroptosis via the SIRT1-NF-κB-p65 signaling pathway
Journal: Chem Biol Interact | Authors: Yitong Yang | Species: mouse,human | Application: WB - A Biocompatible CMCHMA/F127DA Hydrogel with ROS-Scavenging Activity Prevents Postoperative Peritoneal Adhesions.
Journal: ACS Omega | Authors: Zhen Xia | Species: rat | Application: WB - Ginsenoside Rh2-Liposome Potentiate Vaccine Immunity through Enhanced MHC‑I Presentation
Journal: ACS Omega | Authors: Qingqing Nie | Species: mouse | Application: WB - Soyasaponin Bb/Gelatin-Methacryloyl Hydrogel for Cartilage Inflammation Inhibition
Journal: ACS Omega | Authors: Yuhan Jiang | Species: human | Application: WB - ZCL-082, a boron-containing compound, induces apoptosis of non-Hodgkin's lymphoma via targeting p90 ribosomal S6 kinase 1/NF-κB signaling pathway.
Journal: Chem Biol Interact | Authors: Chunmin Ma | Species: human | Application: WB,IP,IF - Salidroside alleviates liver inflammation in furan-induced mice by regulating oxidative stress and endoplasmic reticulum stress.
Journal: Toxicology | Authors: Yuan Yuan | Species: mouse | Application: WB - Baicalin exerts neuroprotective actions by regulating the Nrf2-NLRP3 axis in toxin-induced models of Parkinson's disease
Journal: Chem Biol Interact | Authors: Jiahua Huang | Species: mouse | Application: WB - Astragaloside IV attenuates inflammatory cytokines by inhibiting TLR4/NF-кB signaling pathway in isoproterenol-induced myocardial hypertrophy.
Journal: J Ethnopharmacol | Authors: Juan Yang | Species: rat | Application: WB - Dl-3-n-Butylphthalide Promotes Remyelination and Suppresses Inflammation by Regulating AMPK/SIRT1 and STAT3/NF-κB Signaling in Chronic Cerebral Hypoperfusion.
Journal: Front Aging Neurosci | Authors: Meixi Li | Species: rat | Application: WB - Effects of intraperitoneal injection of SnS2 flowers on mouse testicle.
Journal: Toxicol Sci | Authors: Disi Bai | Species: mouse | Application: WB - Salidroside alleviates liver inflammation in furan-induced mice by regulating oxidative stress and endoplasmic reticulum stress.
Journal: Toxicology | Authors: Yuan Yuan | Species: mouse | Application: WB - Leonurine alleviates LPS-induced myocarditis through suppressing the NF-кB signaling pathway.
Journal: Toxicology | Authors: Ruiyu Wang | Species: mouse | Application: WB,IF - Honokiol protects against acute pancreatitis by activating SIRT3 to restore mitochondrial oxidative phosphorylation and alleviate hyperacetylation.
Journal: J Integr Med | Authors: Yi-fan Miao - Ginsenoside Rh2-Liposome Potentiate Vaccine Immunity through Enhanced MHC‑I Presentation
Journal: ACS Omega | Authors: Qingqing Nie | Species: mouse | Application: WB - miR-221/222 promote cancer stem-like cell properties and tumor growth of breast cancer via targeting PTEN and sustained Akt/NF-κB/COX-2 activation.
Journal: Chem Biol Interact | Authors: Bailong Li | Species: human | Application: WB - Oral administration of sophoricoside (SOP) inhibits neuronal damage and neuroinflammation to curb neurodegeneration in Parkinson's disease
Journal: Chem Biol Interact | Authors: Hefei Wang | Species: mouse | Application: WB - From the Cover: Activation of NF-κB-Autophagy Axis by 2-Hydroxyethyl Methacrylate Commits Dental Mesenchymal Cells to Apoptosis.
Journal: Toxicol Sci | Authors: Jing-Jing Yu | Species: human | Application: WB,IF - Mitochondrial reactive oxygen species initiate gasdermin D-mediated pyroptosis and contribute to paraquat-induced nephrotoxicity
Journal: Chem Biol Interact | Authors: Kaiyuan Chen | Species: human | Application: WB - Effect of Benzyl Isothiocyanate on Anaplastic Thyroid Cancer Evaluated by Network Pharmacology Combined with Experiments
Journal: ACS Omega | Authors: Chunmei Ma | Species: human | Application: WB - Protective role of forsythoside B in Kawasaki disease-induced cardiac injury: Inhibition of pyroptosis via the SIRT1-NF-κB-p65 signaling pathway
Journal: Chem Biol Interact | Authors: Yitong Yang | Species: mouse,human | Application: WB - Dl-3-n-Butylphthalide Promotes Remyelination and Suppresses Inflammation by Regulating AMPK/SIRT1 and STAT3/NF-κB Signaling in Chronic Cerebral Hypoperfusion.
Journal: Front Aging Neurosci | Authors: Meixi Li | Species: rat | Application: WB - miR-221/222 promote cancer stem-like cell properties and tumor growth of breast cancer via targeting PTEN and sustained Akt/NF-κB/COX-2 activation.
Journal: Chem Biol Interact | Authors: Bailong Li | Species: human | Application: WB - Pulpal Pressure Aggravates Pulpitis by Mechano-Inflammatory Signal Synergy.
Journal: Int Dent J | Authors: Weiqi Hu - Ginsenoside Rh2-Liposome Potentiate Vaccine Immunity through Enhanced MHC‑I Presentation
Journal: ACS Omega | Authors: Qingqing Nie | Species: mouse | Application: WB - Diosmetin exerts anti-oxidative, anti-inflammatory and anti-apoptotic effects to protect against endotoxin-induced acute hepatic failure in mice.
Journal: Oncotarget | Authors: You Yang | Species: mouse | Application: WB - Chronic obstructive sleep apnea promotes aortic remodeling in canines through miR-145/Smad3 signaling pathway.
Journal: Oncotarget | Authors: Chengyuan Yu | Species: canine | Application: WB - Biologically active franchetine-type diterpenoid alkaloids: Isolation, synthesis, anti-inflammatory, agalgesic activities, and molecular docking
Journal: Bioorg Chem | Authors: Yan Xiao | Species: mouse | Application: WB,IF - Synergistic Effects of Salvianolic Acid B and Puerarin on Cerebral Ischemia Reperfusion Injury.
Journal: Molecules | Authors: Chengli Ling | Species: rat | Application: WB - Phenolics and terpenoids with good anti-inflammatory activity from the fruits of Amomum villosum and the anti-inflammatory mechanism of active diterpene
Journal: Bioorg Chem | Authors: Yang Xu | Species: mouse | Application: WB,IF - Protective Effect of the Total Flavonoids from Rosa laevigata Michx Fruit on Renal Ischemia-Reperfusion Injury through Suppression of Oxidative Stress and Inflammation.
Journal: Molecules | Authors: Lisha Zhao | Species: rat | Application: WB - FGF-23 regulates MMP-14 expression and angiogenesis via the p85/Akt/mTOR signaling pathway in osteosarcoma.
Journal: Bioorg Chem | Authors: Chun-Han Hou - Daidzein Protects Caco-2 Cells against Lipopolysaccharide-Induced Intestinal Epithelial Barrier Injury by Suppressing PI3K/AKT and P38 Pathways
Journal: Molecules | Authors: Baoping Zhang | Species: human | Application: WB - α-Lipoic acid mitigates age-related cognitive decline by modulating PPARγ/NF-κB-mediated neuroinflammation.
Journal: Exp Gerontol | Authors: Zhenyuan Zhang | Species: mouse | Application: WB - In Vitro and In Vivo Anti-Inflammatory Effects of Polyphyllin VII through Downregulating MAPK and NF-κB Pathways.
Journal: Molecules | Authors: Chao Zhang | Species: mouse | Application: WB - Saponin from Tea (Camellia sinensis) Seed Meal Attenuates Cortisol-Induced Lipogenesis and Inflammation in Human Cells
Journal: Molecules | Authors: Jian Li | Species: human | Application: WB - Acetylharpagide Protects Mice from Staphylococcus Aureus-Induced Acute Lung Injury by Inhibiting NF-κB Signaling Pathway.
Journal: Molecules | Authors: Zhaoxin Zhang | Species: mouse | Application: WB - Acetylharpagide Protects Mice from Staphylococcus Aureus-Induced Acute Lung Injury by Inhibiting NF-κB Signaling Pathway.
Journal: Molecules | Authors: Zhaoxin Zhang | Species: mouse | Application: WB - Photoprotective Effects of Dendrobium officinale Protein Hydrolysate Fractions Against UVB-Induced Photoaging Associated with Modulation of MAPK/NF-κB and TGF-β/Smad Signaling.
Journal: Molecules | Authors: Jinghan Zhang | Species: human | Application: WB - Protective effects of berberine against β-amyloid-induced neurotoxicity in HT22 cells via the Nrf2/HO-1 pathway
Journal: Bioorg Chem | Authors: Ru-Lan Zhang | Species: mouse | Application: WB - Dietary restriction delays the secretion of senescence associated secretory phenotype by reducing DNA damage response in the process of renal aging.
Journal: Exp Gerontol | Authors: Wenjuan Wang | Species: rat | Application: WB - Network Analysis and Experimental Verification of the Mechanisms of Hydroxysafflor Yellow A in Ischemic Stroke Following Atherosclerosis
Journal: Molecules | Authors: Xi Han | Species: rat | Application: IHC - New benzophenone analogs from Nigrospora sphaerica and their inhibitory activity against PD-1/PD-L1 interactions
Journal: Bioorg Chem | Authors: Qi-Xuan Kuang | Application: WB - Daidzein Protects Caco-2 Cells against Lipopolysaccharide-Induced Intestinal Epithelial Barrier Injury by Suppressing PI3K/AKT and P38 Pathways
Journal: Molecules | Authors: Baoping Zhang | Species: human | Application: WB - Protective effects of berberine against β-amyloid-induced neurotoxicity in HT22 cells via the Nrf2/HO-1 pathway
Journal: Bioorg Chem | Authors: Ru-Lan Zhang | Species: mouse | Application: WB - FOXA2 inhibits doxorubicin-induced apoptosis via transcriptionally activating HBP rate-limiting enzyme GFPT1 in HCC cells.
Journal: J Physiol Biochem | Authors: Huang Huang | Species: human | Application: WB,IP - Anti-aging effect of phlorizin on D-galactose-induced aging in mice through antioxidant and anti-inflammatory activity, prevention of apoptosis, and regulation of the gut microbiota.
Journal: Exp Gerontol | Authors: Huiying Chen | Application: WB - Acetylharpagide Protects Mice from Staphylococcus Aureus-Induced Acute Lung Injury by Inhibiting NF-κB Signaling Pathway.
Journal: Molecules | Authors: Zhaoxin Zhang | Species: mouse | Application: WB - In Vitro and In Vivo Anti-Inflammatory Effects of Polyphyllin VII through Downregulating MAPK and NF-κB Pathways.
Journal: Molecules | Authors: Chao Zhang | Species: mouse | Application: WB - α-Lipoic acid mitigates age-related cognitive decline by modulating PPARγ/NF-κB-mediated neuroinflammation.
Journal: Exp Gerontol | Authors: Zhenyuan Zhang | Species: mouse | Application: WB - Dihydroartemisinin alleviates steatosis and inflammation in nonalcoholic steatohepatitis by decreasing endoplasmic reticulum stress and oxidative stress.
Journal: Bioorg Chem | Authors: Tongxi Li | Application: WB - Effects of the total saponins from Rosa laevigata Michx fruit against acetaminophen-induced liver damage in mice via induction of autophagy and suppression of inflammation and apoptosis.
Journal: Molecules | Authors: Deshi Dong | Species: mouse | Application: WB - Synergistic inhibition of tumor growth by MET and COX-2 targeting in gastric and colorectal cancers.
Journal: Bioorg Chem | Authors: Shuai Zhang | Species: human | Application: WB - FOXA2 inhibits doxorubicin-induced apoptosis via transcriptionally activating HBP rate-limiting enzyme GFPT1 in HCC cells.
Journal: J Physiol Biochem | Authors: Huang Huang | Species: human | Application: WB,IP - Onychiol B attenuates lipopolysaccharide-induced inflammation via MAPK/NF-κB pathways and acute lung injury in vivo
Journal: Bioorg Chem | Authors: Xiaoxiao Pei | Species: mouse | Application: WB - The antimicrobial peptide LK2(6)A(L) exhibits anti-inflammatory activity by binding to the myeloid differentiation 2 domain and protects against LPS-induced acute lung injury in mice
Journal: Bioorg Chem | Authors: Juan Zhang | Species: mouse | Application: WB - Synergistic inhibition of tumor growth by MET and COX-2 targeting in gastric and colorectal cancers.
Journal: Bioorg Chem | Authors: Shuai Zhang | Species: human | Application: WB - FOXA2 inhibits doxorubicin-induced apoptosis via transcriptionally activating HBP rate-limiting enzyme GFPT1 in HCC cells.
Journal: J Physiol Biochem | Authors: Huang Huang | Species: human | Application: WB,IP - Anti-aging effect of phlorizin on D-galactose-induced aging in mice through antioxidant and anti-inflammatory activity, prevention of apoptosis, and regulation of the gut microbiota.
Journal: Exp Gerontol | Authors: Huiying Chen | Application: WB - Network Analysis and Experimental Verification of the Mechanisms of Hydroxysafflor Yellow A in Ischemic Stroke Following Atherosclerosis
Journal: Molecules | Authors: Xi Han | Species: rat | Application: IHC - Dexmedetomidine regulates sleep rhythm and alleviates neuroinflammation in rats under high-altitude hypoxia.
Journal: J Physiol Biochem | Authors: Shanshan Liu | Species: rat | Application: WB - Arylacryl amides: Design, synthesis and the protection against cisplatin-induced acute kidney injury via TLR4/STING/NF-κB pathway
Journal: Bioorg Chem | Authors: Xiaoming Wu | Species: mouse,human | Application: WB - Protective Effect of the Total Flavonoids from Rosa laevigata Michx Fruit on Renal Ischemia-Reperfusion Injury through Suppression of Oxidative Stress and Inflammation.
Journal: Molecules | Authors: Lisha Zhao | Species: rat | Application: WB - Dendrobium officinale Polysaccharides as a Natural Functional Component for Acetic-Acid-Induced Gastric Ulcers in Rats
Journal: Molecules | Authors: Miao Zhang | Species: rat | Application: WB - Dihydroartemisinin alleviates steatosis and inflammation in nonalcoholic steatohepatitis by decreasing endoplasmic reticulum stress and oxidative stress.
Journal: Bioorg Chem | Authors: Tongxi Li | Application: WB - Anti-aging effect of phlorizin on D-galactose-induced aging in mice through antioxidant and anti-inflammatory activity, prevention of apoptosis, and regulation of the gut microbiota.
Journal: Exp Gerontol | Authors: Huiying Chen | Application: WB - The role of glycogen synthase kinase-3β (GSK-3β) in endometrial carcinoma: A carcinogenesis, progression, prognosis, and target therapy marker.
Journal: Oncotarget | Authors: Shuo Chen | Species: human | Application: WB - Gen-17, a beta-methyl derivative of Genipin, attenuates LPS-induced ALI by regulating Keap1-Nrf2/HO-1 and suppressing NF-κB and MAPK-dependent signaling pathways
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yu-Shan Zhu | Species: mouse | Application: WB - LPS‑induced proinflammatory cytokine expression in human airway epithelial cells and macrophages via NF‑κB, STAT3 or AP‑1 activation.
Journal: Mol Med Rep | Authors: Xuefang Liu - MD2 mediates COPD pathogenesis by inducing airway inflammation and ferroptosis through the TLR4/MyD88 pathway.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Xinru Xi | Species: mouse,human | Application: WB,IF - Downregulation of transgelin 2 promotes breast cancer metastasis by activating the reactive oxygen species/nuclear factor‑κB signaling pathway.
Journal: Mol Med Rep | Authors: Liu Yang | Species: human | Application: WB - Prostaglandin E2 alleviates inflammatory response and lung injury through EP4/cAMP/IKK/NF-κB pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yelin Tang | Species: mouse | Application: IF - Pressure-mediated mechanosensitive Piezo2 channel is activated in neurogenic bladder and promote bladder fibrosis in children.
Journal: J Mol Med (Berl) | Authors: Lei Lv - Mechanisms underlying the protective effect of tannic acid against arsenic trioxide‑induced cardiotoxicity in rats: Potential involvement of mitochondrial apoptosis.
Journal: Mol Med Rep | Authors: Yucong Xue | Species: rat | Application: WB - Downregulation of TIMP2 attenuates sepsis-induced AKI through the NF-κb pathway.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yi-Ming Li | Species: human | Application: WB - Carnosol inhibits osteoclastogenesis in vivo and in vitro by blocking the RANKL‑induced NF‑κB signaling pathway.
Journal: Mol Med Rep | Authors: Pan Cai | Species: mouse | Application: WB,IF - LPS‑induced proinflammatory cytokine expression in human airway epithelial cells and macrophages via NF‑κB, STAT3 or AP‑1 activation.
Journal: Mol Med Rep | Authors: Xuefang Liu - MD2 mediates COPD pathogenesis by inducing airway inflammation and ferroptosis through the TLR4/MyD88 pathway.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Xinru Xi | Species: mouse,human | Application: WB,IF - M2 macrophage‑derived exosomes alleviate KCa3.1 channel expression in rapidly paced HL‑1 myocytes via the NF‑κB (p65)/STAT3 signaling pathway
Journal: Mol Med Rep | Authors: Huiyu Chen | Species: mouse | Application: WB - Downregulation of transgelin 2 promotes breast cancer metastasis by activating the reactive oxygen species/nuclear factor‑κB signaling pathway.
Journal: Mol Med Rep | Authors: Liu Yang | Species: human | Application: WB - LPS‑induced proinflammatory cytokine expression in human airway epithelial cells and macrophages via NF‑κB, STAT3 or AP‑1 activation.
Journal: Mol Med Rep | Authors: Xuefang Liu - Protective effect of carvacrol on liver injury in type 2 diabetic db/db mice.
Journal: Mol Med Rep | Authors: Wei Zhao | Species: mouse | Application: WB,IHC - Chlorogenic acid prevents inflammatory responses in IL‑1β‑stimulated human SW‑1353 chondrocytes, a model for osteoarthritis.
Journal: Mol Med Rep | Authors: Cui-Cui Liu - Polyphyllin VII induces apoptotic cell death via inhibition of the PI3K/Akt and NF‑κB pathways in A549 human lung cancer cells.
Journal: Mol Med Rep | Authors: Hao He | Species: human | Application: WB - Downregulation of TIMP2 attenuates sepsis-induced AKI through the NF-κb pathway.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yi-Ming Li | Species: human | Application: WB - Regulation of PSAT1 and PHGDH by m6A in endocrine-resistant breast cancer cells.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Kellianne M Piell | Species: human | Application: WB - Dectin1 contributes to hypertensive vascular injury by promoting macrophage infiltration through activating the Syk/NF-κB pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Jiajia Zhang | Species: mouse | Application: WB - Taspine derivative TAS9 regulates cell growth and metastasis of human hepatocellular carcinoma.
Journal: Mol Med Rep | Authors: Rui Liu - Pressure-mediated mechanosensitive Piezo2 channel is activated in neurogenic bladder and promote bladder fibrosis in children.
Journal: J Mol Med (Berl) | Authors: Lei Lv - CIP2A promotes bronchiolitis obliterans by activating the NF‑κB pathway
Journal: Mol Med Rep | Authors: Xu Zhou | Species: rat | Application: WB - Regulatory effects of mangiferin on LPS-induced inflammatory responses and intestinal flora imbalance during sepsis
Journal: Food Sci Nutr | Authors: Bo-Tao Chang | Species: mouse | Application: WB - Flavonoids in Rosa roxburghii Tratt Fermentation Broth Ameliorate Obesity via DNMT3a/SIRT1-Mediated Epigenetic Modulation.
Journal: Food Sci Nutr | Authors: Mi Liu | Species: rat | Application: WB - Acute carbon monoxide poisoning induces renal inflammation and apoptosis via CCL4 upregulation and activation of the PI3K/Akt pathway in mice.
Journal: Mol Med Rep | Authors: Yu Ni | Species: mouse | Application: WB - Downregulation of ENDOCAN in myeloid leukemia cells inhibits proliferation and promotes apoptosis by suppressing nuclear factor‑κB activity.
Journal: Mol Med Rep | Authors: Lingling Sun | Species: human | Application: WB - Prostaglandin E2 alleviates inflammatory response and lung injury through EP4/cAMP/IKK/NF-κB pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yelin Tang | Species: mouse | Application: IF - NF‑κB is negatively associated with Nurr1 to reduce the inflammatory response in Parkinson's disease.
Journal: Mol Med Rep | Authors: Hua Gao | Species: mouse | Application: WB - Shikonin Ameliorates Alcohol-Associated Liver Disease by Reducing Oxidative Stress, Apoptosis, and Inflammation.
Journal: Food Sci Nutr | Authors: Haining Gan | Species: rat | Application: WB - Downregulation of ENDOCAN in myeloid leukemia cells inhibits proliferation and promotes apoptosis by suppressing nuclear factor‑κB activity.
Journal: Mol Med Rep | Authors: Lingling Sun | Species: human | Application: WB - Regulatory effects of mangiferin on LPS-induced inflammatory responses and intestinal flora imbalance during sepsis
Journal: Food Sci Nutr | Authors: Bo-Tao Chang | Species: mouse | Application: WB - H3K27ac-induced IFITM3 promotes progression of TNBC and resistance to anti-PD-1/PD-L1 therapy via the TNF-α/NF-κB/PD-L1 axis.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Guangyan Li | Species: human | Application: WB,IHC,IF - Gen-17, a beta-methyl derivative of Genipin, attenuates LPS-induced ALI by regulating Keap1-Nrf2/HO-1 and suppressing NF-κB and MAPK-dependent signaling pathways
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yu-Shan Zhu | Species: mouse | Application: WB - Regulation of PSAT1 and PHGDH by m6A in endocrine-resistant breast cancer cells.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Kellianne M Piell | Species: human | Application: WB - Edible Bird's Nest Attenuates Neuroinflammation and Cognitive Impairment in a Model of Chronic Fatigue Syndrome.
Journal: Food Sci Nutr | Authors: Xinyuan Wang | Species: mouse | Application: WB - Neuroprotective Effects of dl-3-n-Butylphthalide against Doxorubicin-Induced Neuroinflammation, Oxidative Stress, Endoplasmic Reticulum Stress, and Behavioral Changes.
Journal: Oxid Med Cell Longev | Authors: Dehua Liao | Species: rat | Application: WB - The oncogenic role of TIMM8A in cancer and the mechanistic insights into the function in breast cancer cells
Journal: Sci Rep | Authors: Weiwei Wang | Species: human | Application: WB - Myricetin ameliorates ox-LDL-induced HUVECs apoptosis and inflammation via lncRNA GAS5 upregulating the expression of miR-29a-3p.
Journal: Sci Rep | Authors: Yunpeng Bai | Species: human | Application: WB - α-Linolenic acid alleviates ovalbumin-induced allergic rhinitis in mice and modulates GPR120-NF-κB signaling.
Journal: Sci Rep | Authors: Yulan Song | Species: mouse | Application: WB,IHC - Lymphotoxins Promote the Progression of Human Lymphatic Malformation by Enhancing Lymphatic Endothelial Cell Proliferation.
Journal: Am J Pathol | Authors: Jie-Gang Yang | Species: human | Application: IHC,IF - Combination of Hypoxia-Preconditioned ADSCs and Deferoxamine Can Speed Up the Healing of Diabetic Wounds by Promoting Angiogenesis and Regulating Macrophage Polarization.
Journal: Stem Cell Rev Rep | Authors: Feiyu Cai | Species: mouse | Application: WB - Eupolyphaga sinensis Walker displays inhibition on hepatocellular carcinoma through regulating cell growth and metastasis signaling.
Journal: Sci Rep | Authors: Yanmin Zhang | Species: human | Application: WB - Exosomal miR-203 from bone marrow stem cells targets the SOCS3/NF-κB pathway to regulate neuroinflammation in temporal lobe epilepsy
Journal: World J Stem Cells | Authors: Wei Wang | Species: human | Application: WB - α-Linolenic acid alleviates ovalbumin-induced allergic rhinitis in mice and modulates GPR120-NF-κB signaling.
Journal: Sci Rep | Authors: Yulan Song | Species: mouse | Application: WB,IHC - Propofol inhibits glioma growth by blocking the formation of the NF-κB/LGI4 feedback loop to activate TP53 self-transcription.
Journal: Transl Oncol | Authors: Zhi Wang | Species: human | Application: WB - Potent effects of dioscin against obesity in mice.
Journal: Sci Rep | Authors: Min Liu | Species: mouse | Application: WB - Tumor-Associated Macrophage-Derived CXCL1 Promotes Endometrial Cancer Progression Through the CXCR2/NF-κB Pathway.
Journal: Cancer Sci | Authors: Ruiqi Xia | Species: human | Application: WB,IF - Yanghe Pingchuan Granules Alleviate Airway Inflammation in Bronchial Asthma and Inhibit Pyroptosis by Blocking the TLR4/NF-κB/NRLP3 Signaling Pathway
Journal: Mediators Inflamm | Authors: Lingyu Pan | Species: rat | Application: WB - Propofol inhibits glioma growth by blocking the formation of the NF-κB/LGI4 feedback loop to activate TP53 self-transcription.
Journal: Transl Oncol | Authors: Zhi Wang | Species: human | Application: WB - Neutrophil extracellular trap-related mechanisms in acne vulgaris inspire a novel treatment strategy with adipose-derived stem cells
Journal: Sci Rep | Authors: Honghao Yu | Species: mouse | Application: WB - Induction of PGRN by influenza virus inhibits the antiviral immune responses through downregulation of type I interferons signaling.
Journal: PLoS Pathog | Authors: Fanhua Wei | Species: human | Application: WB - The Gut Microbiota Dysbiosis in Preeclampsia Contributed to Trophoblast Cell Proliferation, Invasion, and Migration via lncRNA BC030099/NF-κB Pathway.
Journal: Mediators Inflamm | Authors: Rong Tang | Species: human | Application: WB - Identification of IL1R1 as a potential key PANoptosis-related gene in myocardial ischemia-reperfusion injury using machine learning.
Journal: Sci Rep | Authors: Shaoyi Peng | Species: mouse,human | Application: WB - LncRNA DDX11-AS1 promotes breast cancer progression by targeting the miR-30c-5p/MTDH axis
Journal: Sci Rep | Authors: Yanting Li | Species: human | Application: WB - Integrated bioinformatics and experimental validation identifies CLIC6 as a novel tumor suppressor regulating NF-κB signaling and immune microenvironment in nasopharyngeal carcinoma.
Journal: Transl Oncol | Authors: Zhuo Chen | Species: human | Application: WB - Liraglutide attenuates autoimmune myocarditis by inhibiting NLRP3 and NF-κb pathways
Journal: Sci Rep | Authors: Lijuan Zhang | Species: mouse | Application: WB - Acute ischemic stroke triggers a cellular senescence-associated secretory phenotype.
Journal: Sci Rep | Authors: Coral Torres-Querol | Species: human | Application: IHC - Extracellular CIRP Upregulates Proinflammatory Cytokine Expression via the NF-kappaB and ERK1/2 Signaling Pathways in Psoriatic Keratinocytes
Journal: Mediators Inflamm | Authors: Xiu Zhang | Species: mouse,human | Application: WB - RNF90 negatively regulates cellular antiviral responses by targeting MITA for degradation.
Journal: PLoS Pathog | Authors: Bo Yang | Species: mouse | Application: WB - Knee loading inhibits osteoclast lineage in a mouse model of osteoarthritis.
Journal: Sci Rep | Authors: Xinle Li | Species: human | Application: WB - Aloe Emodin Reduces Cardiac Inflammation Induced by a High-Fat Diet through the TLR4 Signaling Pathway.
Journal: Mediators Inflamm | Authors: Yingfu Chen | Species: rat | Application: WB - Neutrophil extracellular trap-related mechanisms in acne vulgaris inspire a novel treatment strategy with adipose-derived stem cells
Journal: Sci Rep | Authors: Honghao Yu | Species: mouse | Application: WB - Retinoic acid-loaded PLGA nanocarriers targeting cell cholesterol potentialize the antitumour effect of PD-L1 antibody by preventing epithelial-mesenchymal transition mediated by M2-TAM in colorectal cancer
Journal: Transl Oncol | Authors: Raimundo Fernandes de Araújo Júnior | Species: human | Application: IHC - Nuclear factor-kappa B activity regulates brain expression of P-glycoprotein in the kainic acid-induced seizure rats.
Journal: Mediators Inflamm | Authors: Yu Nian N | Species: rat | Application: IHC - Combination of Hypoxia-Preconditioned ADSCs and Deferoxamine Can Speed Up the Healing of Diabetic Wounds by Promoting Angiogenesis and Regulating Macrophage Polarization.
Journal: Stem Cell Rev Rep | Authors: Feiyu Cai | Species: mouse | Application: WB - p62/SQSTM1 as an oncotarget mediates cisplatin resistance through activating RIP1-NF-κB pathway in human ovarian cancer cells.
Journal: Cancer Sci | Authors: Xiao-Yu Yan | Species: human | Application: WB,IF - Exosomal miR-203 from bone marrow stem cells targets the SOCS3/NF-κB pathway to regulate neuroinflammation in temporal lobe epilepsy
Journal: World J Stem Cells | Authors: Wei Wang | Species: human | Application: WB - Identification of IL1R1 as a potential key PANoptosis-related gene in myocardial ischemia-reperfusion injury using machine learning.
Journal: Sci Rep | Authors: Shaoyi Peng | Species: mouse,human | Application: WB - 6-Gingerol attenuates hepatic ischemia/reperfusion injury through regulating MKP5-mediated P38/JNK pathway
Journal: Sci Rep | Authors: Qiwen Yu | Species: mouse | Application: WB - Potent effects of dioscin against liver fibrosis.
Journal: Sci Rep | Authors: Xiaoling Zhang | Species: mouse | Application: WB - CSF3 promotes colorectal cancer progression by activating p65/NF-κB signaling pathway and inducing an immunosuppressive microenvironment
Journal: Transl Oncol | Authors: Junfeng Xu | Species: human | Application: WB - Yanghe Pingchuan Granules Alleviate Airway Inflammation in Bronchial Asthma and Inhibit Pyroptosis by Blocking the TLR4/NF-κB/NRLP3 Signaling Pathway
Journal: Mediators Inflamm | Authors: Lingyu Pan | Species: rat | Application: WB - Propofol inhibits glioma growth by blocking the formation of the NF-κB/LGI4 feedback loop to activate TP53 self-transcription.
Journal: Transl Oncol | Authors: Zhi Wang | Species: human | Application: WB - Immune cell diversity and regenerative markers reveal interactions among macrophages, rodlet cells, and stem cells in the kidney of Poecilia sphenops
Journal: Sci Rep | Authors: Ramy K A Sayed | Application: IHC - The potential role of the pseudobranch of molly fish (Poecilia sphenops) in immunity and cell regeneration
Journal: Sci Rep | Authors: Doaa M Mokhtar | Application: IHC - Liraglutide attenuates autoimmune myocarditis by inhibiting NLRP3 and NF-κb pathways
Journal: Sci Rep | Authors: Lijuan Zhang | Species: mouse | Application: WB - BMSCs Regulate Astrocytes through TSG-6 to Protect the Blood-Brain Barrier after Subarachnoid Hemorrhage.
Journal: Mediators Inflamm | Authors: Yilv Wan | Species: human | Application: WB - Light-induced Nrf2-/- mice as atrophic age-related macular degeneration model and treatment with nanoceria laden injectable hydrogel.
Journal: Sci Rep | Authors: Kai Wang | Species: mouse | Application: WB - Identification of IL1R1 as a potential key PANoptosis-related gene in myocardial ischemia-reperfusion injury using machine learning.
Journal: Sci Rep | Authors: Shaoyi Peng | Species: mouse,human | Application: WB - SIRT4 functions as a tumor suppressor during prostate cancer by inducing apoptosis and inhibiting glutamine metabolism.
Journal: Sci Rep | Authors: Guohao Cai | Species: human | Application: IF - Retinol binding protein 4 enhances cellular cholesterol uptake to facilitate influenza A virus infection.
Journal: PLoS Pathog | Authors: Hejiao Zhao | Species: mouse,human | Application: WB - Low-intensity pulsed ultrasound (LIPUS) prevents periprosthetic inflammatory loosening through FBXL2-TRAF6 ubiquitination pathway.
Journal: Sci Rep | Authors: Xiang Zhao | Species: mouse | Application: WB - Aloe Emodin Reduces Cardiac Inflammation Induced by a High-Fat Diet through the TLR4 Signaling Pathway.
Journal: Mediators Inflamm | Authors: Yingfu Chen | Species: rat | Application: WB - Light-induced Nrf2-/- mice as atrophic age-related macular degeneration model and treatment with nanoceria laden injectable hydrogel.
Journal: Sci Rep | Authors: Kai Wang | Species: mouse | Application: WB - LncRNA DDX11-AS1 promotes breast cancer progression by targeting the miR-30c-5p/MTDH axis
Journal: Sci Rep | Authors: Yanting Li | Species: human | Application: WB - TNF-α stimulates endothelial palmitic acid transcytosis and promotes insulin resistance.
Journal: Sci Rep | Authors: Wenjing Li | Species: rat | Application: WB - Efficient Delivery of Chlorin e6 by Polyglycerol-Coated Iron Oxide Nanoparticles with Conjugated Doxorubicin for Enhanced Photodynamic Therapy of Melanoma.
Journal: Mol Pharm | Authors: Tong-Fei Li | Species: mouse | Application: WB,IHC - Yanghe Pingchuan Granules Alleviate Airway Inflammation in Bronchial Asthma and Inhibit Pyroptosis by Blocking the TLR4/NF-κB/NRLP3 Signaling Pathway
Journal: Mediators Inflamm | Authors: Lingyu Pan | Species: rat | Application: WB - Protease-Activated Receptor-2 and Phospholipid Metabolism Analysis in Hyperuricemia-Induced Renal Injury
Journal: Mediators Inflamm | Authors: Xiaolu Sui | Species: rat,human | Application: WB - Regulator of G protein signaling-1 facilitates ovarian cancer development by modulating NF-kB signal pathway
Journal: Sci Rep | Authors: Liu Shengnan | Species: human | Application: WB,IHC - Liquiritin, a novel inhibitor of TRPV1 and TRPA1, protects against LPS-induced acute lung injury.
Journal: Cell Calcium | Authors: Zhenhong Liu | Species: mouse,human | Application: WB - Human Bocavirus NS1 and NS1-70 Proteins Inhibit TNF-α-Mediated Activation of NF-κB by targeting p65.
Journal: Sci Rep | Authors: Qingshi Liu | Species: human | Application: WB - Tumor-Associated Macrophage-Derived CXCL1 Promotes Endometrial Cancer Progression Through the CXCR2/NF-κB Pathway.
Journal: Cancer Sci | Authors: Ruiqi Xia | Species: human | Application: WB,IF - α-Linolenic acid alleviates ovalbumin-induced allergic rhinitis in mice and modulates GPR120-NF-κB signaling.
Journal: Sci Rep | Authors: Yulan Song | Species: mouse | Application: WB,IHC - TNF-α stimulates endothelial palmitic acid transcytosis and promotes insulin resistance.
Journal: Sci Rep | Authors: Wenjing Li | Species: rat | Application: WB - SIRT4 functions as a tumor suppressor during prostate cancer by inducing apoptosis and inhibiting glutamine metabolism.
Journal: Sci Rep | Authors: Guohao Cai | Species: human | Application: IF - Exercise mitigates Dapagliflozin-induced skeletal muscle atrophy in STZ-induced diabetic rats
Journal: Diabetol Metab Syndr | Authors: Xudong Yang | Species: rat | Application: WB - LncRNA NKILA regulates endothelium inflammation by controlling a NF-κB/KLF4 positive feedback loop.
Journal: J Mol Cell Cardiol | Authors: Xinxing Zhu | Species: human - TNF-α stimulates endothelial palmitic acid transcytosis and promotes insulin resistance.
Journal: Sci Rep | Authors: Wenjing Li | Species: rat | Application: WB - Lymphotoxins Promote the Progression of Human Lymphatic Malformation by Enhancing Lymphatic Endothelial Cell Proliferation.
Journal: Am J Pathol | Authors: Jie-Gang Yang | Species: human | Application: IHC,IF - Curcumin mitigates polycystic ovary syndrome in mice by suppressing TLR4/MyD88/NF-κB signaling pathway activation and reducing intestinal mucosal permeability
Journal: Sci Rep | Authors: Qin Yang | Species: mouse | Application: WB - Retinoic acid-loaded PLGA nanocarriers targeting cell cholesterol potentialize the antitumour effect of PD-L1 antibody by preventing epithelial-mesenchymal transition mediated by M2-TAM in colorectal cancer
Journal: Transl Oncol | Authors: Raimundo Fernandes de Araújo Júnior | Species: human | Application: IHC - Ethyl pyruvate ameliorates hepatic ischemia-reperfusion injury by inhibiting intrinsic pathway of apoptosis and autophagy.
Journal: Mediators Inflamm | Authors: Miao Shen | Species: mouse | Application: WB - TNF-α stimulates endothelial palmitic acid transcytosis and promotes insulin resistance.
Journal: Sci Rep | Authors: Wenjing Li | Species: rat | Application: WB - Potent effects of dioscin against liver fibrosis.
Journal: Sci Rep | Authors: Xiaoling Zhang | Species: mouse | Application: WB - Identification of IL1R1 as a potential key PANoptosis-related gene in myocardial ischemia-reperfusion injury using machine learning.
Journal: Sci Rep | Authors: Shaoyi Peng | Species: mouse,human | Application: WB - Hypoxia-Inducible Factor-1α-Induced Astrocytic D-Dopachrome Tautomerase Activates Microglial Inflammatory Response following Spinal Cord Injury.
Journal: Am J Pathol | Authors: Aicheng Li | Species: rat | Application: IF - Myricetin ameliorates ox-LDL-induced HUVECs apoptosis and inflammation via lncRNA GAS5 upregulating the expression of miR-29a-3p.
Journal: Sci Rep | Authors: Yunpeng Bai | Species: human | Application: WB - Potent effects of dioscin against liver fibrosis.
Journal: Sci Rep | Authors: Xiaoling Zhang | Species: mouse | Application: WB - Multiple UBXN family members inhibit retrovirus and lentivirus production and canonical NFκΒ signaling by stabilizing IκBα.
Journal: PLoS Pathog | Authors: Yani Hu - 20-hydroxyecdysone suppresses bladder cancer progression via inhibiting USP21: A mechanism associated with deubiquitination and degradation of p65
Journal: Transl Oncol | Authors: Qiang Ma | Species: human | Application: WB,IHC,IF - The oncogenic role of TIMM8A in cancer and the mechanistic insights into the function in breast cancer cells
Journal: Sci Rep | Authors: Weiwei Wang | Species: human | Application: WB - Protective Effect of Methane-Rich Saline on Acetic Acid-Induced Ulcerative Colitis via Blocking the TLR4/NF-κB/MAPK Pathway and Promoting IL-10/JAK1/STAT3-Mediated Anti-inflammatory Response.
Journal: Oxid Med Cell Longev | Authors: Guanghui Wang | Species: mouse | Application: WB - Jmjd3 is involved in the susceptibility to depression induced by maternal separation via enhancing the neuroinflammation in the prefrontal cortex and hippocampus of male rats.
Journal: Exp Neurol | Authors: Rui Wang | Species: rat | Application: WB - Study on the effect and mechanism of Zhenzhu Tongluo pills in treating diabetic peripheral neuropathy injury
Journal: Eur J Med Res | Authors: Pengfei Dong | Species: rat | Application: WB - DLGAP5 regulates malignancy and lenvatinib sensitivity of hepatocellular carcinoma through AKT/mTOR/NF-κB pathway.
Journal: Eur J Med Res | Authors: Benyi He | Species: human | Application: WB - Indoleamine 2, 3-dioxygenase 1 inhibition mediates the therapeutic effects in Parkinson's disease mice by modulating inflammation and neurogenesis in a gut microbiota dependent manner
Journal: Exp Neurol | Authors: Chen-Meng Qiao | Species: mouse | Application: WB - FUT3-B3GNT3 interaction promotes pancreatic cancer progression and chemoresistance via NF-κB signaling mediated autophagy.
Journal: Eur J Med Res | Authors: Lei Jin | Species: human | Application: WB - TFAP2C Knockdown Sensitizes Bladder Cancer Cells to Cisplatin Treatment via Regulation of EGFR and NF-κB
Journal: Cancers (Basel) | Authors: Ji Xing | Species: mouse,human | Application: WB - Jmjd3 is involved in the susceptibility to depression induced by maternal separation via enhancing the neuroinflammation in the prefrontal cortex and hippocampus of male rats.
Journal: Exp Neurol | Authors: Rui Wang | Species: rat | Application: WB - IRAK1 deficiency potentiates the efficacy of radiotherapy in repressing cervical cancer development
Journal: Cell Signal | Authors: Wenjuan Chen | Species: human | Application: WB,IF - The Combination of MIF Inhibitor and AEP Targeted Inhibitor to Reduce Lung Metastasis in Breast Cancer and Its Mechanism
Journal: J Cell Mol Med | Authors: Junsong Chen | Application: WB - Annexin-1 is an oncogene in glioblastoma and causes tumour immune escape through the indirect upregulation of interleukin-8.
Journal: J Cell Mol Med | Authors: Rui Chen | Species: human | Application: WB - Wogonin alleviates liver injury in sepsis through Nrf2-mediated NF-κB signalling suppression.
Journal: J Cell Mol Med | Authors: Ji-Min Dai | Species: mouse | Application: WB - Downregulated fat mass and obesity-associated protein inhibits bone resorption and osteoclastogenesis by nuclear factor-kappa B inactivation
Journal: Cell Signal | Authors: Jinpeng Zhuang | Species: mouse | Application: WB - Downregulated fat mass and obesity-associated protein inhibits bone resorption and osteoclastogenesis by nuclear factor-kappa B inactivation
Journal: Cell Signal | Authors: Jinpeng Zhuang | Species: mouse | Application: WB - Curcumin alleviates lipopolysaccharide-induced alveolar epithelial Glycocalyx damage by modulating the Rac1/NF-κB/HPSE pathway
Journal: Cell Signal | Authors: Wenxia Xu | Species: mouse,human | Application: WB - Whey protein powder with milk fat globule membrane attenuates Alzheimer's disease pathology in 3×Tg-AD mice by modulating neuroinflammation through the peroxisome proliferator-activated receptor γ signaling pathway
Journal: J Dairy Sci | Authors: Yu Li | Species: mouse | Application: WB - Pharmacological Network Analysis of the Functions and Mechanism of Quercetin From Jisuikang (JSK) in Spinal Cord Injury (SCI)
Journal: J Cell Mol Med | Authors: Lini Dong | Species: mouse | Application: WB - TLR4 contributes to the damage of cartilage and subchondral bone in discectomy-induced TMJOA mice.
Journal: J Cell Mol Med | Authors: Xin Liu | Species: human | Application: IHC - Research of heat-killed Loigolactobacillus coryniformis NA-3 and Lactiplantibacillus plantarum NA as potential substitutes for live strains in immune regulation and anti-inflammatory effects.
Journal: World J Microbiol Biotechnol | Authors: Xiaoqing Xu | Species: mouse | Application: WB - Downregulated fat mass and obesity-associated protein inhibits bone resorption and osteoclastogenesis by nuclear factor-kappa B inactivation
Journal: Cell Signal | Authors: Jinpeng Zhuang | Species: mouse | Application: WB - Annexin-1 is an oncogene in glioblastoma and causes tumour immune escape through the indirect upregulation of interleukin-8.
Journal: J Cell Mol Med | Authors: Rui Chen | Species: human | Application: WB - Macrophage C3aR1 Mediates Sepsis-Induced Myocardial Injury by Triggering Neutrophil Necroptosis.
Journal: J Cell Mol Med | Authors: Jianbo Xu | Species: rat | Application: WB - E3 ubiquitin ligase FBXW11 as a novel inflammatory biomarker is associated with immune infiltration and NF-κB pathway activation in pancreatitis and pancreatic cancer
Journal: Cell Signal | Authors: Peng Tan | Species: mouse | Application: WB - Study on the antioxidant and anti-inflammatory properties of different morphologies of ceria nanoenzymes with multi enzyme mimetic activity.
Journal: J Mater Sci Mater Med | Authors: Ziyu Song | Species: mouse | Application: WB - GRP78 is implicated in the modulation of tumor aerobic glycolysis by promoting autophagic degradation of IKKβ.
Journal: Cell Signal | Authors: Zongwei Li | Species: human | Application: WB - The Combination of MIF Inhibitor and AEP Targeted Inhibitor to Reduce Lung Metastasis in Breast Cancer and Its Mechanism
Journal: J Cell Mol Med | Authors: Junsong Chen | Application: WB - DLC-1 induces mitochondrial apoptosis and epithelial mesenchymal transition arrest in nasopharyngeal carcinoma by targeting EGFR/Akt/NF-κB pathway.
Journal: Med Oncol | Authors: Wei Huang | Species: human | Application: WB - African Swine Fever Virus MGF360-12L Inhibits Type I Interferon Production by Blocking the Interaction of Importin α and NF-κB Signaling Pathway.
Journal: Virol Sin | Authors: Yisha Zhuo | Species: human | Application: WB,IF - Downregulation of DNA-PKcs suppresses P-gp expression via inhibition of the Akt/NF-κB pathway in CD133-positive osteosarcoma MG-63 cells.
Journal: Oncol Rep | Authors: Ka Li - Pseudorabies virus VHS protein abrogates interferon responses by blocking NF-κB and IRF3 nuclear translocation
Journal: Virol Sin | Authors: Zhenfang Yan | Species: rabbit,pig,mouse,human - α7‑nAchR agonist GTS‑21 reduces radiation‑induced lung injury.
Journal: Oncol Rep | Authors: Zijie Mei | Species: mouse | Application: IHC - Staphylococcal enterotoxin M induced inflammation and impairment of bovine mammary epithelial cells.
Journal: J Dairy Sci | Authors: Yanying Zhao | Species: bovine | Application: WB - A novel nano material for anti-cerebral ischemia: Preparation and Application of Borneol Angelica Polysaccharide Liposomes.
Journal: J Liposome Res | Authors: Huang Ding | Species: rat | Application: WB - Fatty acids promote M1 polarization of monocyte-derived macrophages in healthy or ketotic dairy cows and a bovine macrophage cell line via impairing mTOR-mediated autophagy
Journal: J Dairy Sci | Authors: Xudong Sun | Species: bovine | Application: WB - IFI16 Induced by p53 Activates the NF-κB Pathway to Counteract Cisplatin-Induced Apoptosis in Cervical Cancer Cells.
Journal: J Cell Mol Med | Authors: Lili Zhong | Species: human | Application: WB,IF - Wogonin alleviates liver injury in sepsis through Nrf2-mediated NF-κB signalling suppression.
Journal: J Cell Mol Med | Authors: Ji-Min Dai | Species: mouse | Application: WB - Fatty acid synthase inhibitor cerulenin attenuates glioblastoma progression by reducing EMT and stemness phenotypes, inducing oxidative and ER stress response, and targeting PI3K/AKT/NF-κB axis
Journal: Med Oncol | Authors: Murat Pekmez | Species: human | Application: WB - African Swine Fever Virus MGF360-12L Inhibits Type I Interferon Production by Blocking the Interaction of Importin α and NF-κB Signaling Pathway.
Journal: Virol Sin | Authors: Yisha Zhuo | Species: human | Application: WB,IF - IFI16 Induced by p53 Activates the NF-κB Pathway to Counteract Cisplatin-Induced Apoptosis in Cervical Cancer Cells.
Journal: J Cell Mol Med | Authors: Lili Zhong | Species: human | Application: WB,IF - RPPH1 promotes the progression of High-Risk acute myeloid leukemia through NF-κB signaling and Th17 expression.
Journal: Med Oncol | Authors: Manqing Wang | Species: human | Application: WB - GRP78 is implicated in the modulation of tumor aerobic glycolysis by promoting autophagic degradation of IKKβ.
Journal: Cell Signal | Authors: Zongwei Li | Species: human | Application: WB - Loss of FAM172A gene prompts cell proliferation in liver regeneration
Journal: Mol Cell Biochem | Authors: Herui Wei | Species: mouse,human | Application: WB - TGF-β3-mediated phagocytosis protects mammary epithelial cells of ketotic dairy cows against metabolic stress-induced inflammatory damage
Journal: J Dairy Sci | Authors: Renxu Chang | Application: WB - Treatment with a probiotic combination reduces abdominal adhesion in rats by decreasing intestinal inflammation and restoring microbial composition.
Journal: Oncol Rep | Authors: Xiaorong Deng | Species: rat | Application: WB - Calpain-1 mediates vascular remodelling and fibrosis via HIF-1α in hypoxia-induced pulmonary hypertension.
Journal: J Cell Mol Med | Authors: Haiyan Deng | Application: WB,IF - The m6A methyltransferase METTL3 cooperates with demethylase ALKBH5 to regulate osteogenic differentiation through NF-κB signaling.
Journal: Mol Cell Biochem | Authors: Jinjin Yu | Application: WB - Annexin-1 is an oncogene in glioblastoma and causes tumour immune escape through the indirect upregulation of interleukin-8.
Journal: J Cell Mol Med | Authors: Rui Chen | Species: human | Application: WB - TLR4 contributes to the damage of cartilage and subchondral bone in discectomy-induced TMJOA mice.
Journal: J Cell Mol Med | Authors: Xin Liu | Species: human | Application: IHC - α7‑nAchR agonist GTS‑21 reduces radiation‑induced lung injury.
Journal: Oncol Rep | Authors: Zijie Mei | Species: mouse | Application: IHC - A novel 2-iminobenzimidazole compound, XYA1353, displays in vitro and in vivo anti-myeloma activity via targeting NF-κB signaling
Journal: Mol Cell Biochem | Authors: Jian Gao | Species: mouse,human | Application: WB,IHC,IF - TGF-β3-mediated phagocytosis protects mammary epithelial cells of ketotic dairy cows against metabolic stress-induced inflammatory damage
Journal: J Dairy Sci | Authors: Renxu Chang | Application: WB - The Combination of MIF Inhibitor and AEP Targeted Inhibitor to Reduce Lung Metastasis in Breast Cancer and Its Mechanism
Journal: J Cell Mol Med | Authors: Junsong Chen | Application: WB - Loss of FAM172A gene prompts cell proliferation in liver regeneration
Journal: Mol Cell Biochem | Authors: Herui Wei | Species: mouse,human | Application: WB - c-Myc participates in high glucose-mediated endothelial inflammation via upregulation of IRAK1 expression in diabetic nephropathy.
Journal: Cell Signal | Authors: Wenting Hou | Species: human | Application: WB,IHC - Carvacrol alleviates endoplasmic reticulum stress and inflammation induced by lipopolysaccharide by enhancing endoplasmic reticulum autophagy in dairy mammary epithelial cells
Journal: J Dairy Sci | Authors: Yue Yang | Application: WB - Electroacupuncture Regulates Oxidative Stress-Mediated NLRP3/ASC/Caspase-1 Pathway to Inhibit Microglial Activation: Alleviating Neuroinflammation and Depression in IBD.
Journal: J Inflamm Res | Authors: Zuqiang Li | Species: mouse | Application: WB - Overexpression of G Protein-Coupled Receptor 40 Protects Obesity-Induced Cardiomyopathy Through the SIRT1/LKB1/AMPK Pathway
Journal: Hum Gene Ther | Authors: Sheng-Nan Li | Application: WB - Study on the Anti-Atherosclerotic Mechanisms of Xin-Tong-Tai Granule Through Network Pharmacology, Molecular Docking, and Experimental Validation
Journal: J Inflamm Res | Authors: Junping Zhu | Species: mouse,human | Application: WB,IHC - Correlational analysis of PLIN1 with inflammation in diabetic foot ulcer wounds
Journal: Diabetes Res Clin Pract | Authors: Mengting Wang | Species: human | Application: WB - Transcriptomics and Network Pharmacology Reveal Anti-Inflammatory and Anti-Oxidative Stress Mechanisms of Qingxuan Runmu Yin in Dry Eye Disease.
Journal: J Inflamm Res | Authors: Shanshan Zhao | Species: human | Application: WB - Microcystin-leucine arginine (MC-LR) induced inflammatory response in bovine sertoli cell via TLR4/NF-kB signaling pathway.
Journal: Environ Toxicol Pharmacol | Authors: E O Adegoke | Species: human | Application: WB - Salvianolic Acid B Improves Chronic Mild Stress-Induced Depressive Behaviors in Rats: Involvement of AMPK/SIRT1 Signaling Pathway.
Journal: J Inflamm Res | Authors: Dehua Liao | Species: rat | Application: WB - Characterization of the Roles of Suppressor of Cytokine Signaling-3 in Esophageal Carcinoma
Journal: Hum Gene Ther | Authors: Xiaojie Yang | Application: WB - Correlational analysis of PLIN1 with inflammation in diabetic foot ulcer wounds
Journal: Diabetes Res Clin Pract | Authors: Mengting Wang | Species: human | Application: WB - Development of new dehydrocostuslactone derivatives for treatment of atopic dermatitis via inhibition of the NF-κB signaling pathway
Journal: RSC Med Chem | Authors: Xiaoyi Li | Species: mouse | Application: WB - Transcriptomics and Network Pharmacology Reveal Anti-Inflammatory and Anti-Oxidative Stress Mechanisms of Qingxuan Runmu Yin in Dry Eye Disease.
Journal: J Inflamm Res | Authors: Shanshan Zhao | Species: human | Application: WB - MicroRNA-3178 ameliorates inflammation and gastric carcinogenesis promoted by Helicobacter pylori new toxin, Tip-α, by targeting TRAF3.
Journal: Helicobacter | Authors: Meijuan Zou | Species: human | Application: WB - Transcriptomics and Network Pharmacology Reveal Anti-Inflammatory and Anti-Oxidative Stress Mechanisms of Qingxuan Runmu Yin in Dry Eye Disease.
Journal: J Inflamm Res | Authors: Shanshan Zhao | Species: human | Application: WB - Identification of Macrophage-Related Biomarkers for Abdominal Aortic Aneurysm Through Combined Single-Cell Sequencing and Machine Learning
Journal: J Inflamm Res | Authors: Guoqing Yao | Species: human | Application: WB - Silybin ameliorates Pb-induced learning and memory impairment by inhibiting STAT3/hnRNP U/REST and NFκB/hnRNP U.
Journal: Environ Toxicol Pharmacol | Authors: Wei Zhang | Species: rat | Application: WB - Chitosan/Sodium Alginate/Velvet Antler Blood Peptides Hydrogel Promotes Diabetic Wound Healing via Regulating Angiogenesis, Inflammatory Response and Skin Flora
Journal: J Inflamm Res | Authors: Mingqian Hao | Species: mouse | Application: WB - Tenascin-C Facilitates Microglial Polarization via TLR4/MyD88/NF-κB Pathway Following Subarachnoid Hemorrhage
Journal: J Inflamm Res | Authors: Zheng-Qing Hu | Species: mouse | Application: WB - Hylotelephium mingjinianum Extract Attenuates Oxidative Stress and Inflammation in Experimental Periodontitis.
Journal: J Inflamm Res | Authors: Lin Yuan | Species: rat | Application: WB,IHC,IF - Development of new dehydrocostuslactone derivatives for treatment of atopic dermatitis via inhibition of the NF-κB signaling pathway
Journal: RSC Med Chem | Authors: Xiaoyi Li | Species: mouse | Application: WB - Mitochondrial TXN2 attenuates amyloidogenesis via selective inhibition of BACE1 expression.
Journal: J Neurochem | Authors: Kun-Yi Li | Species: human | Application: WB - Microcystin-leucine arginine (MC-LR) induced inflammatory response in bovine sertoli cell via TLR4/NF-kB signaling pathway.
Journal: Environ Toxicol Pharmacol | Authors: E O Adegoke | Species: human | Application: WB - Salvianolic Acid B Improves Chronic Mild Stress-Induced Depressive Behaviors in Rats: Involvement of AMPK/SIRT1 Signaling Pathway.
Journal: J Inflamm Res | Authors: Dehua Liao | Species: rat | Application: WB - Isoliquiritigenin Alleviates Periodontitis by Suppressing Inflammation via NF-κB Signaling Pathway of Immune Cell
Journal: J Inflamm Res | Authors: Xiao Wang | Species: mouse | Application: WB - MicroRNA-3178 ameliorates inflammation and gastric carcinogenesis promoted by Helicobacter pylori new toxin, Tip-α, by targeting TRAF3.
Journal: Helicobacter | Authors: Meijuan Zou | Species: human | Application: WB - LT-α Facilitates the Aerobic Glycolysis and M1 Polarization of Macrophages by Activating the NF-κB Signaling Pathway in Intervertebral Disc Degeneration
Journal: J Inflamm Res | Authors: Chensheng Qiu | Application: WB - Heparanase-driven inflammation from the AGEs-stimulated macrophages changes the functions of glomerular endothelial cells.
Journal: Diabetes Res Clin Pract | Authors: Guang Xu | Species: mouse | Application: WB - Mitochondrial TXN2 attenuates amyloidogenesis via selective inhibition of BACE1 expression.
Journal: J Neurochem | Authors: Kun-Yi Li | Species: human | Application: WB - Losartan Ameliorates Calcium Oxalate-Induced Elevation of Stone-Related Proteins in Renal Tubular Cells by Inhibiting NADPH Oxidase and Oxidative Stress.
Journal: Oxid Med Cell Longev | Authors: Baolong Qin | Species: rat | Application: WB - Crocin ameliorates arsenic trioxide‑induced cardiotoxicity via Keap1-Nrf2/HO-1 pathway: Reducing oxidative stress, inflammation, and apoptosis.
Journal: Biomed Pharmacother | Authors: Yingran Liang | Species: rat | Application: WB - Procyanidins and its metabolites by gut microbiome improves insulin resistance in gestational diabetes mellitus mice model via regulating NF-κB and NLRP3 inflammasome pathway.
Journal: Biomed Pharmacother | Authors: Yao Liu | Species: mouse | Application: WB - Dexmedetomidine exerts cardioprotective effect through miR-146a-3p targeting IRAK1 and TRAF6 via inhibition of the NF-κB pathway.
Journal: Biomed Pharmacother | Authors: Liang He | Species: rat | Application: WB - Toll-like receptor 4 deficiency alleviates lipopolysaccharide-induced intestinal barrier dysfunction
Journal: Biomed Pharmacother | Authors: Lianghui Zhan | Species: mouse | Application: WB - Crocin ameliorates arsenic trioxide‑induced cardiotoxicity via Keap1-Nrf2/HO-1 pathway: Reducing oxidative stress, inflammation, and apoptosis.
Journal: Biomed Pharmacother | Authors: Yingran Liang | Species: rat | Application: WB - Modification of taxifolin particles with an enteric coating material promotes repair of acute liver injury in mice through modulation of inflammation and autophagy signaling pathway.
Journal: Biomed Pharmacother | Authors: Qiteng Ding | Species: mouse | Application: WB - Achyranthes bidentata polysaccharides alleviate endoplasmic reticulum stress in osteoarthritis via lncRNA NEAT1/miR-377-3p pathway
Journal: Biomed Pharmacother | Authors: Changlong Fu | Species: mouse | Application: WB - Cocaine Regulates NLRP3 Inflammasome Activity and CRF Signaling in a Region- and Sex-Dependent Manner in Rat Brain
Journal: Biomedicines | Authors: Yan Cheng | Species: rat | Application: WB - CDDO-Im exerts antidepressant-like effects via the Nrf2/ARE pathway in a rat model of post-stroke depression.
Journal: Brain Res Bull | Authors: Xiaoli Hou | Species: rat | Application: WB - Dietary dimethylglycine alleviates cyclic heat stress-induced jejunal injury in yellow-feathered broilers by inhibiting the TLR4/NF-κB signaling pathway and restoring MUC2 expression.
Journal: Poult Sci | Authors: Dan Shao | Species: chicken | Application: WB - Machine learning-based integration develops a hypoxia-derived signature for improving outcomes in glioma.
Journal: iScience | Authors: Quanwei Zhou - GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: role of NF-κB and MAPK signaling pathways.
Journal: Brain Res Bull | Authors: Fei Liu | Species: rat | Application: WB - miR-671-5p Attenuates Neuroinflammation via Suppressing NF-κB Expression in an Acute Ischemic Stroke Model.
Journal: Neurochem Res | Authors: Ling Deng | Species: mouse | Application: WB,IF - Enriched environment mitigates depressive behavior by changing the inflammatory activation phenotype of microglia in the hippocampus of depression model rats.
Journal: Brain Res Bull | Authors: Jing-Yang Gu | Species: rat | Application: WB - Inhibition of Nogo-B reduces the progression of pancreatic cancer by regulation NF-κB/GLUT1 and SREBP1 pathways
Journal: iScience | Authors: Tianxiang Wang | Species: human | Application: WB - Conjugated Linoleic Acid Ameliorates High Fructose-Induced Hyperuricemia and Renal Inflammation in Rats via NLRP3 Inflammasome and TLR4 Signaling Pathway
Journal: Mol Nutr Food Res | Authors: Jianyang Tan | Species: rat | Application: WB - Resolvin D1 Modulates the Inflammatory Processes of Human Periodontal Ligament Cells via NF-κB and MAPK Signaling Pathways.
Journal: Biomedicines | Authors: Jing Yan | Species: human | Application: WB - Pathogenic mechanism of Eimeria tenella EtMIC2 promotes Eimeria tenella invasion and inhibits host cell apoptosis through binding to the ITGAV receptor.
Journal: Poult Sci | Authors: Kai-Ling Cui | Species: chicken | Application: WB - β-chitosan attenuates hepatic macrophage-driven inflammation and reverses aging-related cognitive impairment
Journal: iScience | Authors: Chenming Zou | Species: mouse | Application: WB - Tumor Necrosis Factor-stimulated Gene-6 (TSG-6) Secreted by BMSCs Regulates Activated Astrocytes by Inhibiting NF-κB Signaling Pathway to Ameliorate Blood Brain Barrier Damage After Intracerebral Hemorrhage.
Journal: Neurochem Res | Authors: Bin Tang | Species: rat | Application: WB - Antidepressant-like Effect of Merazin Hydrate Depends on NO/ERK by Suppressing Its Downstream NF-κB or Nonactivating CREB/BDNF in Mouse Hippocampus.
Journal: ACS Chem Neurosci | Authors: Lei Wu | Species: mouse | Application: WB - Trans-anethole ameliorates lipopolysaccharide-induced acute liver inflammation in broilers via inhibiting NF-κB signaling pathway.
Journal: Poult Sci | Authors: Yichun Tong | Species: chicken | Application: WB - ANRIL regulating the secretion of Muc5ac induced by atmospheric PM2.5 via NF-κB pathway in Beas-2B cells
Journal: Environ Toxicol | Authors: Liting Zhou | Species: human | Application: WB,IF - DNAJB9 promotes epithelial-mesenchymal transition in the nasal epithelium of chronic rhinosinusitis by enhancing TRIM22-mediated IκBα degradation.
Journal: iScience | Authors: Zhiqiang Zhang | Species: mouse,human | Application: WB - High-throughput RNA sequencing identifies hub genes and anti-inflammatory effects of β-caryophyllene in cerebral ischemia-reperfusion via p38MAPK/NF-κB modulation.
Journal: Brain Res Bull | Authors: Jingdong Liu | Species: rat | Application: WB - MSR405: Inhibiting Neuroinflammation after Spinal Cord Injury in Rats
Journal: Biomedicines | Authors: Yu Liu | Species: mouse | Application: WB - Metabolic Engineering of Commensal Bacteria for Producing 5-Hydroxyindoleacetic Acid as a Therapeutic Strategy for Colitis.
Journal: ACS Synth Biol | Authors: Wei Du | Species: mouse | Application: WB - ANRIL regulating the secretion of Muc5ac induced by atmospheric PM2.5 via NF-κB pathway in Beas-2B cells
Journal: Environ Toxicol | Authors: Liting Zhou | Species: human | Application: WB,IF - Partial Replacement of NaCl with KCl in Cooked Meat Could Reduce the Liver Damage Through Renin-Angiotensin System in Mice
Journal: Mol Nutr Food Res | Authors: Lifang Zou | Species: mouse | Application: IF - CDDO-Im exerts antidepressant-like effects via the Nrf2/ARE pathway in a rat model of post-stroke depression.
Journal: Brain Res Bull | Authors: Xiaoli Hou | Species: rat | Application: WB - GABAB receptor mediate hippocampal neuroinflammation in adolescent male and female mice after cold expose.
Journal: Brain Res Bull | Authors: Bin Xu | Species: mouse | Application: WB - Targeted inhibition of microglial C5aR1 by PMX205 mitigates post-ischemic stroke neuroinflammation and promotes functional recovery.
Journal: Brain Res Bull | Authors: Jie Cao | Species: mouse | Application: WB - Neuroprotection of Andrographolide Against Microglia-Mediated Inflammatory Injury and Oxidative Damage in PC12 Neurons.
Journal: Neurochem Res | Authors: Yuanzhen Xu | Species: rat | Application: WB,IF - Trans-anethole ameliorates lipopolysaccharide-induced acute liver inflammation in broilers via inhibiting NF-κB signaling pathway.
Journal: Poult Sci | Authors: Yichun Tong | Species: chicken | Application: WB - Silencing of PTX3 alleviates LPS-induced inflammatory pain by regulating TLR4/NF-κB signaling pathway in mice.
Journal: Biosci Rep | Authors: Shuang Qi | Species: mouse | Application: WB - Inhibition of transient receptor potential melastatin 8 alleviates airway inflammation and remodeling in a murine model of asthma with cold air stimulus.
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Haipei Liu | Species: mouse | Application: WB - Protective effects of sodium humate and its zinc and selenium chelate on the oxidative stress, inflammatory, and intestinal barrier damage of Salmonella Typhimurium-challenged broiler chickens
Journal: Poult Sci | Authors: Yuying Fan | Species: chicken | Application: WB - S100A4/NF-κB axis mediates the anticancer effect of epigallocatechin-3-gallate in platinum-resistant ovarian cancer
Journal: iScience | Authors: Xiaoli Li | Species: human | Application: WB - Partial Replacement of NaCl with KCl in Cooked Meat Could Reduce the Liver Damage Through Renin-Angiotensin System in Mice
Journal: Mol Nutr Food Res | Authors: Lifang Zou | Species: mouse | Application: IF - Mesenchymal stem cell exosomes inhibit nucleus pulposus cell apoptosis via the miR-125b-5p/TRAF6/NF-κB pathway axis
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Yang Duan | Species: rat,human | Application: WB,IF - Protective effects of sodium humate and its zinc and selenium chelate on the oxidative stress, inflammatory, and intestinal barrier damage of Salmonella Typhimurium-challenged broiler chickens
Journal: Poult Sci | Authors: Yuying Fan | Species: chicken | Application: WB - SUN5 interacts with TRIM28, enhancing IκBα ubiquitination to promote glycolysis in colorectal cancer cells.
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Jingyuan Chen | Species: human | Application: IF - Inflammation conditional genome editing mediated by the CRISPR-Cas9 system
Journal: iScience | Authors: Tingting Yuan | Species: mouse | Application: WB - Verapamil Attenuates the Severity of Tendinopathy by Mitigating Mitochondrial Dysfunction through the Activation of the Nrf2/HO-1 Pathway
Journal: Biomedicines | Authors: Zengguang Wang | Species: rat | Application: WB - Dietary dimethylglycine alleviates cyclic heat stress-induced jejunal injury in yellow-feathered broilers by inhibiting the TLR4/NF-κB signaling pathway and restoring MUC2 expression.
Journal: Poult Sci | Authors: Dan Shao | Species: chicken | Application: WB - ATF6 ameliorates renal warm ischemia-reperfusion injury through FHL2-mediated NF-κB signaling pathway.
Journal: iScience | Authors: Xuan Wu | Species: mouse,human | Application: WB - The NF-κB/NUAK2 signaling axis regulates pancreatic cancer progression by targeting SMAD2/3
Journal: iScience | Authors: Ruobing Wang | Species: human | Application: WB,ChIP - Pretreatment with Lactobacillus reuteri F-9-35 attenuates ethanol-induced gastric injury in rats.
Journal: Food Nutr Res | Authors: Mao-Cheng Sun | Species: human | Application: WB - Ellagic acid alleviates DSS-induced ulcerative colitis by inhibiting ROS/NLRP3 pathway activation and modulating gut microbiota in mice
Journal: Eur J Nutr | Authors: Yanling Xiong | Species: mouse | Application: IHC - CDDO-Im exerts antidepressant-like effects via the Nrf2/ARE pathway in a rat model of post-stroke depression.
Journal: Brain Res Bull | Authors: Xiaoli Hou | Species: rat | Application: WB - Immunomodulatory and Anti-Inflammatory Effects of Phycocyanin Oligopeptide Combined with Selenium and Zinc in LPS-Induced Mice.
Journal: Biomedicines | Authors: Kazim Sahin | Species: mouse | Application: WB - S100A4/NF-κB axis mediates the anticancer effect of epigallocatechin-3-gallate in platinum-resistant ovarian cancer
Journal: iScience | Authors: Xiaoli Li | Species: human | Application: WB - Enriched environment mitigates depressive behavior by changing the inflammatory activation phenotype of microglia in the hippocampus of depression model rats.
Journal: Brain Res Bull | Authors: Jing-Yang Gu | Species: rat | Application: WB - Ellagic acid alleviates DSS-induced ulcerative colitis by inhibiting ROS/NLRP3 pathway activation and modulating gut microbiota in mice
Journal: Eur J Nutr | Authors: Yanling Xiong | Species: mouse | Application: IHC - DNAJB9 promotes epithelial-mesenchymal transition in the nasal epithelium of chronic rhinosinusitis by enhancing TRIM22-mediated IκBα degradation.
Journal: iScience | Authors: Zhiqiang Zhang | Species: mouse,human | Application: WB - CDDO-Im exerts antidepressant-like effects via the Nrf2/ARE pathway in a rat model of post-stroke depression.
Journal: Brain Res Bull | Authors: Xiaoli Hou | Species: rat | Application: WB - DNAJB9 promotes epithelial-mesenchymal transition in the nasal epithelium of chronic rhinosinusitis by enhancing TRIM22-mediated IκBα degradation.
Journal: iScience | Authors: Zhiqiang Zhang | Species: mouse,human | Application: WB - The Nrf2/HMGB1/NF-κB axis modulates chondrocyte apoptosis and extracellular matrix degradation in osteoarthritis
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Wenzhao Li | Species: human | Application: WB - Interleukin-27 is a multitarget regulator of fibroblast remodeling in thyroid-associated ophthalmopathy.
Journal: iScience | Authors: Pengbo Zhang | Species: human | Application: WB - Periodontitis aggravates atherosclerosis by inducing inflammatory response and macrophage pyroptosis through the NF-κB/NLRP3/caspase-1 pathway.
Journal: J Periodontol | Authors: Bin Su | Species: mouse | Application: IF - The NF-κB/NUAK2 signaling axis regulates pancreatic cancer progression by targeting SMAD2/3
Journal: iScience | Authors: Ruobing Wang | Species: human | Application: WB,ChIP - Naringin against doxorubicin-induced hepatotoxicity in mice through reducing oxidative stress, inflammation, and apoptosis via the up-regulation of SIRT1
Journal: Environ Toxicol | Authors: Yan Xi | Species: mouse | Application: WB - GABAB receptor mediate hippocampal neuroinflammation in adolescent male and female mice after cold expose.
Journal: Brain Res Bull | Authors: Bin Xu | Species: mouse | Application: WB - Puerarin Alleviates Depression via Integrated Regulation of TLR4/MyD88/NF-κB Signaling and Gut Microbiota-Metabolic Axis.
Journal: Neurochem Res | Authors: Xin-Yi Cao | Species: rat | Application: IF - Resolvin D1 in the Lipopolysaccharide-Induced Inflammatory Microenvironment Mediates Resolution in Human Monocytic THP-1 Cells.
Journal: Biomedicines | Authors: Zhe Xing | Species: human | Application: WB - Distinct pathways utilized by METTL3 to regulate antiviral innate immune response
Journal: iScience | Authors: Haojie Hao | Species: human | Application: WB - GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: role of NF-κB and MAPK signaling pathways.
Journal: Brain Res Bull | Authors: Fei Liu | Species: rat | Application: WB - Neuroprotection of Andrographolide Against Microglia-Mediated Inflammatory Injury and Oxidative Damage in PC12 Neurons.
Journal: Neurochem Res | Authors: Yuanzhen Xu | Species: rat | Application: WB,IF - JQ1 attenuates neuroinflammation by inhibiting the inflammasome-dependent canonical pyroptosis pathway in SAE
Journal: Brain Res Bull | Authors: Xiaolin Zhong | Species: mouse | Application: WB - Puerarin Alleviates Depression via Integrated Regulation of TLR4/MyD88/NF-κB Signaling and Gut Microbiota-Metabolic Axis.
Journal: Neurochem Res | Authors: Xin-Yi Cao | Species: rat | Application: IF - Dietary resveratrol supplementation inhibits heat stress-induced high-activated innate immunity and inflammatory response in spleen of yellow-feather broilers.
Journal: Poult Sci | Authors: Shaoping He | Species: CHICKEN | Application: WB - Ellagic acid alleviates DSS-induced ulcerative colitis by inhibiting ROS/NLRP3 pathway activation and modulating gut microbiota in mice
Journal: Eur J Nutr | Authors: Yanling Xiong | Species: mouse | Application: IHC - Galangin alleviates cold stress-induced splenic injury in Danzhou chickens by inhibiting NLRP3 inflammasome-mediated pyroptosis.
Journal: Poult Sci | Authors: Xueqi Tian | Species: chicken | Application: WB - Inflammation conditional genome editing mediated by the CRISPR-Cas9 system
Journal: iScience | Authors: Tingting Yuan | Species: mouse | Application: WB - Interleukin-27 is a multitarget regulator of fibroblast remodeling in thyroid-associated ophthalmopathy.
Journal: iScience | Authors: Pengbo Zhang | Species: human | Application: WB - NF-κB and AP-1 are required for the lipopolysaccharide-induced expression of MCP-1, CXCL1, and Cx43 in cultured rat dorsal spinal cord astrocytes
Journal: Front Mol Neurosci | Authors: Ying Lu | Species: rat | Application: WB,IF - Anti-inflammatory effect of Ganluyin, a Chinese classic prescription, in chronic pharyngitis rat model.
Journal: BMC Complement Med Ther | Authors: Ye-Hui Chen | Species: rat | Application: WB - Isorhamnetin protects against D-GalN/LPS-induced acute liver injury in mice through anti-oxidative stress, anti-inflammation, and anti-apoptosis
Journal: BMC Complement Med Ther | Authors: Li Long | Species: mouse - Enhanced enrichment of extracellular vesicles for laboratory and clinical research from drop-sized blood samples
Journal: Front Mol Biosci | Authors: Alexa Guerrero-Alba | Species: pig,human | Application: WB - HDLR-SR-BI Expression and Cholesterol Uptake are Regulated via Indoleamine-2,3-dioxygenase 1 in Macrophages under Inflammation
Journal: Langmuir | Authors: Avisankar Chini | Species: human | Application: WB - NF-κB and AP-1 are required for the lipopolysaccharide-induced expression of MCP-1, CXCL1, and Cx43 in cultured rat dorsal spinal cord astrocytes
Journal: Front Mol Neurosci | Authors: Ying Lu | Species: rat | Application: WB,IF - Interleukin-17 suppresses grass carp reovirus infection in Ctenopharyngodon idellus kidney cells by activating NF-κB signaling.
Journal: Aquaculture | Authors: Yunshan Zhang | Application: WB - Ursolic Acid Ameliorates Spinal Cord Injury in Mice by Regulating Gut Microbiota and Metabolic Changes.
Journal: Front Cell Neurosci | Authors: Zi-Jie Rong | Species: mouse | Application: WB - HDLR-SR-BI Expression and Cholesterol Uptake are Regulated via Indoleamine-2,3-dioxygenase 1 in Macrophages under Inflammation
Journal: Langmuir | Authors: Avisankar Chini | Species: human | Application: WB - Enhanced enrichment of extracellular vesicles for laboratory and clinical research from drop-sized blood samples
Journal: Front Mol Biosci | Authors: Alexa Guerrero-Alba | Species: pig,human | Application: WB - Mulberrin alleviates triclocarban induced hepatic apoptosis and inflammation by regulating the ROS/NF-κB pathway in grass carp
Journal: Comp Biochem Physiol C Toxicol Pharmacol | Authors: Siwen Li | Application: WB - NF-κB and AP-1 are required for the lipopolysaccharide-induced expression of MCP-1, CXCL1, and Cx43 in cultured rat dorsal spinal cord astrocytes
Journal: Front Mol Neurosci | Authors: Ying Lu | Species: rat | Application: WB,IF - Effects of Si-Miao-Yong-An decoction on myocardial I/R rats by regulating gut microbiota to inhibit LPS-induced TLR4/NF-κB signaling pathway
Journal: BMC Complement Med Ther | Authors: Yuting Cui | Species: rat | Application: WB - IRAK-M Deficiency Exacerbates Ischemic Neurovascular Injuries in Experimental Stroke Mice.
Journal: Front Cell Neurosci | Authors: Chenfei Lyu | Species: mouse | Application: WB - Sevoflurane-Induced Neuroapoptosis in Rat Dentate Gyrus Is Activated by Autophagy Through NF-κB Signaling on the Late-Stage Progenitor Granule Cells.
Journal: Front Cell Neurosci | Authors: Dongyi Tong | Species: rat | Application: WB - Isorhamnetin protects against D-GalN/LPS-induced acute liver injury in mice through anti-oxidative stress, anti-inflammation, and anti-apoptosis
Journal: BMC Complement Med Ther | Authors: Li Long | Species: mouse - Interleukin-17 suppresses grass carp reovirus infection in Ctenopharyngodon idellus kidney cells by activating NF-κB signaling.
Journal: Aquaculture | Authors: Yunshan Zhang | Application: WB - Hsa_circ_0056558 regulates cyclin-dependent kinase 6 by sponging microRNA-1290 to suppress the proliferation and differentiation in ankylosing spondylitis.
Journal: Autoimmunity | Authors: Xia Li | Species: human | Application: WB - Monitoring the Early Antiproliferative Effect of the Analgesic-Antitumor Peptide, BmK AGAP on Breast Cancer Using Intravoxel Incoherent Motion With a Reduced Distribution of Four b-Values.
Journal: Front Physiol | Authors: Natacha Raissa Doudou | Species: human | Application: WB,IHC - BPA Exacerbates Zinc Deficiency-Induced Testicular Tissue Inflammation in Male Mice Through the TNF-α/NF-κB/Caspase8 Signaling Pathway
Journal: Biol Trace Elem Res | Authors: Xinying Wang | Species: mouse | Application: WB - Palmatine ameliorates N-methyl-N'-nitrosoguanidine-induced chronic atrophic gastritis through the STAT1/CXCL10 axis
Journal: FASEB J | Authors: Yuan Zhou | Species: mouse,human | Application: WB - TUFM is involved in Alzheimer's disease-like pathologies that are associated with ROS.
Journal: FASEB J | Authors: Bi-Rou Zhong | Species: human | Application: WB - The role and mechanism of RIPK1 in vascular endothelial dysfunction in chronic kidney disease
Journal: FASEB J | Authors: Cheng Wang | Species: mouse,human | Application: WB,IF - Chronic Waterborne Exposure to Polystyrene Microplastics Induces Kupffer Cell Polarization Imbalance and Hepatic Lipid Accumulation.
Journal: FASEB J | Authors: Ting Li | Species: mouse | Application: WB - Caragana korshinskii Tannin Attenuates LPS-Induced Sheep Rumen Epithelial Injury via TLR4/MyD88/NF-κB Signaling.
Journal: Biology (Basel) | Authors: Xiaojia Mu - Hsa_circ_0056558 regulates cyclin-dependent kinase 6 by sponging microRNA-1290 to suppress the proliferation and differentiation in ankylosing spondylitis.
Journal: Autoimmunity | Authors: Xia Li | Species: human | Application: WB - ANXA4 Alleviates Cardiomyocyte Injury Associated With Ischemia-Reperfusion by Interfering With NFκB p50's Transcriptional Activation of RAGE.
Journal: FASEB J | Authors: Zhihan Zhao | Species: mouse | Application: WB,ChIP - Pre-ischemic renal lavage protects against renal ischemia-reperfusion injury by attenuation of local and systemic inflammatory responses.
Journal: FASEB J | Authors: Shuiming Guo | Species: rat,mouse | Application: WB - Taurine Attenuates M1 Macrophage Polarization and IL-1β Production by Suppressing the JAK1/2-STAT1 Pathway via Metabolic Reprogramming.
Journal: Biology (Basel) | Authors: Zi'an Zhang | Species: mouse | Application: WB - The role and mechanism of RIPK1 in vascular endothelial dysfunction in chronic kidney disease
Journal: FASEB J | Authors: Cheng Wang | Species: mouse,human | Application: WB,IF - Palmatine ameliorates N-methyl-N'-nitrosoguanidine-induced chronic atrophic gastritis through the STAT1/CXCL10 axis
Journal: FASEB J | Authors: Yuan Zhou | Species: mouse,human | Application: WB - Hsa_circ_0056558 regulates cyclin-dependent kinase 6 by sponging microRNA-1290 to suppress the proliferation and differentiation in ankylosing spondylitis.
Journal: Autoimmunity | Authors: Xia Li | Species: human | Application: WB - BPA Exacerbates Zinc Deficiency-Induced Testicular Tissue Inflammation in Male Mice Through the TNF-α/NF-κB/Caspase8 Signaling Pathway
Journal: Biol Trace Elem Res | Authors: Xinying Wang | Species: mouse | Application: WB - Inflammatory mediator contributes to leptin resistance and obesity in craniopharyngioma
Journal: FASEB J | Authors: Youchao Xiao | Species: rat,human | Application: WB - Cold Exposure Induces Intestinal Barrier Damage and Endoplasmic Reticulum Stress in the Colon via the SIRT1/Nrf2 Signaling Pathway.
Journal: Front Physiol | Authors: Jingru Guo | Species: mouse | Application: WB - Chronic Waterborne Exposure to Polystyrene Microplastics Induces Kupffer Cell Polarization Imbalance and Hepatic Lipid Accumulation.
Journal: FASEB J | Authors: Ting Li | Species: mouse | Application: WB - Epstein-Barr virus tegument protein BGLF2 inhibits NF-κB activity by preventing p65 Ser536 phosphorylation.
Journal: FASEB J | Authors: Tao Chen | Species: human | Application: WB - Cold Exposure Induces Intestinal Barrier Damage and Endoplasmic Reticulum Stress in the Colon via the SIRT1/Nrf2 Signaling Pathway.
Journal: Front Physiol | Authors: Jingru Guo | Species: mouse | Application: WB - TUFM is involved in Alzheimer's disease-like pathologies that are associated with ROS.
Journal: FASEB J | Authors: Bi-Rou Zhong | Species: human | Application: WB - Lactobacillus johnsonii L531 ameliorates enteritis via elimination of damaged mitochondria and suppression of SQSTM1-dependent mitophagy in a Salmonella infantis model of piglet diarrhea.
Journal: FASEB J | Authors: Bing Xia | Species: pig | Application: WB,IHC - Taurine Attenuates M1 Macrophage Polarization and IL-1β Production by Suppressing the JAK1/2-STAT1 Pathway via Metabolic Reprogramming.
Journal: Biology (Basel) | Authors: Zi'an Zhang | Species: mouse | Application: WB - Orosomucoid 1 Participates in Alveolar Hypercoagulation and Fibrinolytic Inhibition Involving NF-κB Signaling Pathway in LPS-Induced ARDS.
Journal: FASEB J | Authors: Xianjun Chen | Species: rat | Application: WB - Caragana korshinskii Tannin Attenuates LPS-Induced Sheep Rumen Epithelial Injury via TLR4/MyD88/NF-κB Signaling.
Journal: Biology (Basel) | Authors: Xiaojia Mu - Human umbilical cord mesenchymal stem cells derived extracellular vesicles alleviate salpingitis by promoting M1-to-M2 transformation
Journal: Front Physiol | Authors: Changlin Zhang | Species: mouse | Application: WB - Inflammatory mediator contributes to leptin resistance and obesity in craniopharyngioma
Journal: FASEB J | Authors: Youchao Xiao | Species: rat,human | Application: WB - Lactobacillus johnsonii L531 ameliorates enteritis via elimination of damaged mitochondria and suppression of SQSTM1-dependent mitophagy in a Salmonella infantis model of piglet diarrhea.
Journal: FASEB J | Authors: Bing Xia | Species: pig | Application: WB,IHC - Mechanisms of Aletris spicata (Thunb.) Franch. Extract in Asthma Therapy: Oxidative Stress, Inflammation, and Gut Microbiota
Journal: Biology (Basel) | Authors: Jing Yang - ANXA4 Alleviates Cardiomyocyte Injury Associated With Ischemia-Reperfusion by Interfering With NFκB p50's Transcriptional Activation of RAGE.
Journal: FASEB J | Authors: Zhihan Zhao | Species: mouse | Application: WB,ChIP - Lactobacillus johnsonii L531 ameliorates enteritis via elimination of damaged mitochondria and suppression of SQSTM1-dependent mitophagy in a Salmonella infantis model of piglet diarrhea.
Journal: FASEB J | Authors: Bing Xia | Species: pig | Application: WB,IHC - The inflammatory responses in Cu-mediated elemental imbalance is associated with mitochondrial fission and intrinsic apoptosis in Gallus gallus heart.
Journal: Chemosphere | Authors: Siwen Li | Species: human | Application: WB - Mucous cell histopathology and label-free quantitative proteomic analysis of skin mucus in fat greenling (Hexagrammos otakii) infected with Vibrio harveyi
Journal: Fish Shellfish Immunol | Authors: Xiaoyan Wei | Application: WB - The protease ADAMTS5 controls ovarian cancer cell invasion, downstream of Rab25
Journal: FEBS J | Authors: Shengnan Yuan | Species: human | Application: WB,IF - Androgen aggravates liver fibrosis by activation of NLRP3 inflammasome in CCl4-induced liver injury mouse model.
Journal: Am J Physiol Endocrinol Metab | Authors: Xingyu Ma | Species: mouse | Application: WB - Mucous cell histopathology and label-free quantitative proteomic analysis of skin mucus in fat greenling (Hexagrammos otakii) infected with Vibrio harveyi
Journal: Fish Shellfish Immunol | Authors: Xiaoyan Wei | Application: WB - Asprosin aggravates nonalcoholic fatty liver disease via inflammation and lipid metabolic disturbance mediated by reactive oxygen species
Journal: Drug Dev Res | Authors: Chaowen Wang | Species: mouse,human | Application: WB - Colistin-induced nephrotoxicity in mice involves the mitochondrial, death receptor, and endoplasmic reticulum pathways.
Journal: Antimicrob Agents Chemother | Authors: Chongshan Dai | Species: mouse | Application: WB - Long noncoding RNA GAS5 alleviates the inflammatory response of human periodontal ligament stem cells by regulating the NF-κB signalling pathway
Journal: Eur J Orthod | Authors: Qiaolin Yang | Species: mouse,human | Application: WB,IF - Citric acid promotes SPARC release in pancreatic cancer cells and inhibits the progression of pancreatic tumors in mice on a high-fat diet
Journal: FEBS J | Authors: Guohui Xiao | Species: mouse,human | Application: WB,IHC - MGP Promotes Colon Cancer Proliferation by Activating the NF-κB Pathway through Upregulation of the Calcium Signaling Pathway.
Journal: Mol Ther Oncolytics | Authors: Xueqing Li | Species: human | Application: WB,IF - Inhibition of high-fat diet-induced obesity via reduction of ER-resident protein Nogo occurs through multiple mechanisms.
Journal: J Biol Chem | Authors: Xiaolin Wang | Application: WB - Therapeutic Effects of Lifei Decoction in a Murine Model of COPD Induced by LPS and Cigarette Smoke
Journal: Int J Chron Obstruct Pulmon Dis | Authors: Liguo Lu | Species: mouse | Application: WB - RNA binding motif protein 3 (RBM3) promotes protein kinase B (AKT) activation to enhance glucose metabolism and reduce apoptosis in skeletal muscle of mice under acute cold exposure
Journal: Cell Stress Chaperones | Authors: Yang Liu | Species: mouse | Application: WB - Mechanisms of Qingyi Decoction in Severe Acute Pancreatitis-Associated Acute Lung Injury via Gut Microbiota: Targeting the Short-Chain Fatty Acids-Mediated AMPK/NF-κB/NLRP3 Pathway
Journal: Microbiol Spectr | Authors: Zhengjian Wang | Species: mouse | Application: WB,IF - Irisolidone Ameliorates Cyclophosphamide-Induced POI via Inhibiting Inflammatory Response.
Journal: Front Biosci (Landmark Ed) | Authors: Mingjin Li | Species: mouse | Application: WB,IHC - Transmissible gastroenteritis virus induces inflammatory responses via RIG-I/NF-κB/HIF-1α/glycolysis axis in intestinal organoids and in vivo
Journal: J Virol | Authors: Yunhang Zhang | Species: pig | Application: WB,IF - Abnormal Polyamine Metabolism in Pancreatic Epithelial Cells aggravates chronic pancreatitis-associated preneoplastic lesions.
Journal: Front Biosci (Landmark Ed) | Authors: Yuhong Zhang - Transmissible gastroenteritis virus induces inflammatory responses via RIG-I/NF-κB/HIF-1α/glycolysis axis in intestinal organoids and in vivo
Journal: J Virol | Authors: Yunhang Zhang | Species: pig | Application: WB,IF - Fish Snx27 promotes viral products by modulating the innate immune response and exosomal machinery
Journal: J Virol | Authors: Yepin Yu | Application: WB - Irisolidone Ameliorates Cyclophosphamide-Induced POI via Inhibiting Inflammatory Response.
Journal: Front Biosci (Landmark Ed) | Authors: Mingjin Li | Species: mouse | Application: WB,IHC - Herpes simplex virus type 1 protein kinase US3 hyperphosphorylates p65/RelA and dampens NF-κB activation.
Journal: J Virol | Authors: Kezhen Wang | Species: human | Application: WB - The safety assessment of cinnabar: Effects of co-administration with selenium on renal toxicity in mice
Journal: J Trace Elem Med Biol | Authors: Ziyan Han | Species: mouse | Application: WB - Porcine reproductive and respiratory syndrome virus nsp5 inhibits the activation of the Nrf2/HO-1 pathway by targeting p62 to antagonize its antiviral activity
Journal: J Virol | Authors: Fang Wang | Species: pig | Application: WB - Epstein-Barr virus envelope glycoprotein 110 inhibits NF-κB activation by interacting with NF-κB subunit p65
Journal: J Biol Chem | Authors: Mingsheng Cai | Species: human | Application: WB,IF,CoIP - RNA binding motif protein 3 (RBM3) promotes protein kinase B (AKT) activation to enhance glucose metabolism and reduce apoptosis in skeletal muscle of mice under acute cold exposure
Journal: Cell Stress Chaperones | Authors: Yang Liu | Species: mouse | Application: WB - Hepatitis B virus core protein promotes the expression of neuraminidase 1 to facilitate hepatocarcinogenesis.
Journal: Lab Invest | Authors: Fanyun Kong | Species: human | Application: WB,IF - Transmissible gastroenteritis virus induces inflammatory responses via RIG-I/NF-κB/HIF-1α/glycolysis axis in intestinal organoids and in vivo
Journal: J Virol | Authors: Yunhang Zhang | Species: pig | Application: WB,IF - Icariside II attenuates eosinophils-induced airway inflammation and remodeling via inactivation of NF-κB and STAT3 in an asthma mouse model.
Journal: Exp Mol Pathol | Authors: Chunyan Tian | Species: mouse | Application: WB - Polychlorinated biphenyl quinones promotes breast cancer metastasis through ROS-mediated nuclear factor kappa B-matrix metalloproteinase signaling.
Journal: Chem Res Toxicol | Authors: Yuxin Wang | Species: human | Application: WB,IF - Lipopolysaccharide in Bile Promotes the Neutrophil Extracellular Traps-Induced Gallstone Formation by Activating the Gallbladder Immune Barrier
Journal: Immunotargets Ther | Authors: Jingjing Yu | Species: mouse | Application: WB - Fish Snx27 promotes viral products by modulating the innate immune response and exosomal machinery
Journal: J Virol | Authors: Yepin Yu | Application: WB - Epstein-Barr Virus Envelope Glycoprotein gp110 Inhibits IKKi-Mediated Activation of NF-κB and Promotes the Degradation of β-Catenin
Journal: Microbiol Spectr | Authors: Yingjie Guo | Species: human | Application: WB - The safety assessment of cinnabar: Effects of co-administration with selenium on renal toxicity in mice
Journal: J Trace Elem Med Biol | Authors: Ziyan Han | Species: mouse | Application: WB - Ginseng Saponin Rb1 Attenuates Cigarette Smoke Exposure-Induced Inflammation, Apoptosis and Oxidative Stress via Activating Nrf2 and Inhibiting NF-κB Signaling Pathways
Journal: Int J Chron Obstruct Pulmon Dis | Authors: Zhizheng Li | Species: human | Application: WB - RNA binding motif protein 3 (RBM3) promotes protein kinase B (AKT) activation to enhance glucose metabolism and reduce apoptosis in skeletal muscle of mice under acute cold exposure
Journal: Cell Stress Chaperones | Authors: Yang Liu | Species: mouse | Application: WB - Hepatitis B virus core protein promotes the expression of neuraminidase 1 to facilitate hepatocarcinogenesis.
Journal: Lab Invest | Authors: Fanyun Kong | Species: human | Application: WB,IF - The mitochondrial chaperone Prohibitin 1 negatively regulates interleukin-8 in human liver cancers.
Journal: J Biol Chem | Authors: Jin Won Yang | Species: human | Application: WB - ADGRG6 Promotes Pancreatic Adenocarcinoma Progression Through the NF-κB/STAT6 Axis and Modulation of the Tumor Immune Microenvironment.
Journal: Curr Issues Mol Biol | Authors: Lisha Li | Species: human | Application: WB - Herpes Simplex Virus 1 E3 Ubiquitin Ligase ICP0 Protein Inhibits TNF-α-induced NF-κB Activation by Interacting with p65/RelA and p50/NF-κB1.
Journal: J Virol | Authors: Zhang Jie J | Species: human | Application: WB,IP - Sirt1 Negatively Regulates Cellular Antiviral Responses by Preventing the Cytoplasmic Translocation of Interferon-Inducible Protein 16 in Human Cells
Journal: J Virol | Authors: Jie Wang | Species: human | Application: WB - Transmissible gastroenteritis virus induces inflammatory responses via RIG-I/NF-κB/HIF-1α/glycolysis axis in intestinal organoids and in vivo
Journal: J Virol | Authors: Yunhang Zhang | Species: pig | Application: WB,IF - Galacturonic Acid Alleviates Lipopolysaccharide-Induced Macrophage Inflammation Potentially Through Competitively Inhibiting the TLR4/NF-κB Pathway.
Journal: J Food Sci | Authors: Yan Li | Species: mouse | Application: WB,IF - The mitochondrial chaperone Prohibitin 1 negatively regulates interleukin-8 in human liver cancers.
Journal: J Biol Chem | Authors: Jin Won Yang | Species: human | Application: WB - LncRNA-SUSAJ1 Activates the ER Stress Pathway Inhibiting JEV Proliferation by Promoting PK15 Cells Apoptosis
Journal: Front Biosci (Landmark Ed) | Authors: Qiongyu Yuan | Species: pig | Application: WB - StAR-related lipid transfer domain 11 (STARD11)-mediated ceramide transport mediates extracellular vesicle biogenesis.
Journal: J Biol Chem | Authors: Masanori Fukushima | Species: mouse | Application: WB - Porcine reproductive and respiratory syndrome virus nsp5 inhibits the activation of the Nrf2/HO-1 pathway by targeting p62 to antagonize its antiviral activity
Journal: J Virol | Authors: Fang Wang | Species: pig | Application: WB - StAR-related lipid transfer domain 11 (STARD11)-mediated ceramide transport mediates extracellular vesicle biogenesis.
Journal: J Biol Chem | Authors: Masanori Fukushima | Species: mouse | Application: WB - Role of IL-6-IL-27 Complex in Host Antiviral Immune Response.
Journal: J Immunol | Authors: Qi Zuo | Application: WB - Abberent Expression of NOR1 Protein in Tumor Associated Macrophages Contributes to the Development of DEN-Induced Hepatocellular Carcinoma.
Journal: J Cell Physiol | Authors: Shengnan Chen | Species: human | Application: IHC - Evaluation of the post-treatment anti-inflammatory capacity of osteoarthritic chondrocytes: An in vitro study using baicalein.
Journal: Regen Ther | Authors: Chang-Chin Wu | Species: human | Application: WB - The chemokine receptor type 5 inhibitor maraviroc alleviates sepsis-associated liver injury by regulating MAPK/NF-κB signaling
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Jun Shao | Species: mouse | Application: WB - Bronchial epithelial-derived exosomal SLC6A14 promotes airway inflammation and mucus hypersecretion via the ZFP36L1/IL-8 axis.
Journal: Funct Integr Genomics | Authors: Yurong Xiao | Species: human | Application: WB - Uncovering the molecular mechanism of solasonine in treating interstitial cystitis via network pharmacology and molecular docking.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Yifan Ma | Species: human | Application: WB - Functional food potential of Anoectochilus roxburghii aqueous extract: UPLC-MS profiling and in vivo efficacy in type 2 diabetic mice.
Journal: J Sci Food Agric | Authors: Ping Li | Species: mouse | Application: IHC - Neonatal resveratrol administration promotes skeletal muscle growth and insulin sensitivity in intrauterine growth-retarded suckling piglets associated with activation of FGF21-AMPKα pathway
Journal: J Sci Food Agric | Authors: Guangyi Bai | Species: pig | Application: WB - PRKRA promotes pancreatic cancer progression by upregulating MMP1 transcription via the NF-κB pathway
Journal: Heliyon | Authors: Jiangdong Qiu | Species: human | Application: ChIP - NAC1 Potentiates Cellular Antiviral Signaling by Bridging MAVS and TBK1.
Journal: J Immunol | Authors: Zhangchuan Xia | Species: human | Application: WB - Biglycan knockdown improves Graves' orbitopathy (GO)-like features via inhibiting NF-kB and ERK signaling.
Journal: J Endocrinol Invest | Authors: Changci Chenzhao | Species: mouse,human | Application: WB - Functional food potential of Anoectochilus roxburghii aqueous extract: UPLC-MS profiling and in vivo efficacy in type 2 diabetic mice.
Journal: J Sci Food Agric | Authors: Ping Li | Species: mouse | Application: IHC - Bronchial epithelial-derived exosomal SLC6A14 promotes airway inflammation and mucus hypersecretion via the ZFP36L1/IL-8 axis.
Journal: Funct Integr Genomics | Authors: Yurong Xiao | Species: human | Application: WB - NAC1 Potentiates Cellular Antiviral Signaling by Bridging MAVS and TBK1.
Journal: J Immunol | Authors: Zhangchuan Xia | Species: human | Application: WB - Astragalus polysaccharide improves diabetic ulcers by promoting M2-polarization of macrophages to reduce excessive inflammation via the β-catenin/ NF-κB axis at the late phase of wound-healing
Journal: Heliyon | Authors: Zhang Zhen | Species: rat | Application: WB - Tinosinenside A inhibits neuroinflammation and protects HT22 cells by suppressing the TLR4/NF-κB/NLRP3 signaling pathway in BV2 cells
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Yongyan Xie | Species: mouse | Application: WB - L-Theanine alleviates heat stress through modulation of gut microbiota and immunity
Journal: J Sci Food Agric | Authors: Sha Liu | Species: mouse | Application: WB - Arenobufagin increases the sensitivity of gastric cancer to cisplatin via alkaliptosis
Journal: Heliyon | Authors: Chengwei Liu | Species: human | Application: WB,IF - Bronchial epithelial-derived exosomal SLC6A14 promotes airway inflammation and mucus hypersecretion via the ZFP36L1/IL-8 axis.
Journal: Funct Integr Genomics | Authors: Yurong Xiao | Species: human | Application: WB - Anti-inflammatory activities of several diterpenoids isolated from Hemionitis albofusca
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Xiaoxiao Pei | Species: mouse | Application: WB - Aberrant centrosome biogenesis disrupts nephron and collecting duct progenitor growth and fate resulting in fibrocystic kidney disease
Journal: Development | Authors: Tao Cheng | Species: mouse | Application: WB - Biglycan knockdown improves Graves' orbitopathy (GO)-like features via inhibiting NF-kB and ERK signaling.
Journal: J Endocrinol Invest | Authors: Changci Chenzhao | Species: mouse,human | Application: WB - Uncovering the mechanisms of diosmin in treating obesity-related kidney injury based on network pharmacology, molecular docking, and in vitro validation
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Jun-Xing Zhu | Species: human | Application: WB - Anticancer effect of SZC015 on pancreatic cancer via mitochondria-dependent apoptosis and the constitutive suppression of activated nuclear factor κB and STAT3 in vitro and in vivo.
Journal: J Cell Physiol | Authors: Yanlin Song | Species: human | Application: WB - Inducible ATP1B1 Upregulates Antiviral Innate Immune Responses by the Ubiquitination of TRAF3 and TRAF6.
Journal: J Immunol | Authors: Wei Cao | Species: human | Application: WB - Tinosinenside A inhibits neuroinflammation and protects HT22 cells by suppressing the TLR4/NF-κB/NLRP3 signaling pathway in BV2 cells
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Yongyan Xie | Species: mouse | Application: WB - β-Nicotinamide mononucleotide protects against hypervirulent Klebsiella pneumoniae bloodstream infection and liver injury
Journal: mSphere | Authors: Zubai Cao | Species: mouse,human | Application: WB,IF - Abberent Expression of NOR1 Protein in Tumor Associated Macrophages Contributes to the Development of DEN-Induced Hepatocellular Carcinoma.
Journal: J Cell Physiol | Authors: Shengnan Chen | Species: human | Application: IHC - Adipose-derived mesenchymal stem cells ameliorate the inflammatory reaction in CLP-induced septic acute lung injury rats via sTNFR1.
Journal: J Cell Physiol | Authors: Xian-Fei Ding | Species: rat | Application: WB - The chemokine receptor type 5 inhibitor maraviroc alleviates sepsis-associated liver injury by regulating MAPK/NF-κB signaling
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Jun Shao | Species: mouse | Application: WB - Neonatal resveratrol administration promotes skeletal muscle growth and insulin sensitivity in intrauterine growth-retarded suckling piglets associated with activation of FGF21-AMPKα pathway
Journal: J Sci Food Agric | Authors: Guangyi Bai | Species: pig | Application: WB - Functional food potential of Anoectochilus roxburghii aqueous extract: UPLC-MS profiling and in vivo efficacy in type 2 diabetic mice.
Journal: J Sci Food Agric | Authors: Ping Li | Species: mouse | Application: IHC - Uncovering the molecular mechanism of solasonine in treating interstitial cystitis via network pharmacology and molecular docking.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Yifan Ma | Species: human | Application: WB - Inhibitor of apoptosis stimulating p53 protein (iASPP) protects against inflammatory bowel disease (IBD) in mice models by inhibiting the NF-κB signaling.
Journal: Clin Exp Immunol | Authors: Ke Qian | Species: mouse | Application: WB - Bilobalide alleviates ischemia-reperfusion injury during liver transplantation by regulating macrophage polarization through inhibiting NF-κB pathway.
Journal: Hepatobiliary Pancreat Dis Int | Authors: Yi-Xiao Tang | Species: rat | Application: WB,IHC,IF - Combined treatment with glucosamine and chondroitin sulfate improves rheumatoid arthritis in rats by regulating the gut microbiota
Journal: Nutr Metab (Lond) | Authors: Xuesong Wang | Species: rat | Application: IHC - Morchella esculenta polysaccharide attenuate obesity, inflammation and modulate gut microbiota
Journal: AMB Express | Authors: Ata Ur Rehman | Species: mouse | Application: WB - The Role and Mechanism of TRIM13 Regulation of TRAF6 Ubiquitination in the Synergy of Inflammatory Responses and Neurotoxicity Induced by METH and HIV- 1 Tat Protein in Astrocytes
Journal: Neurotox Res | Authors: Yi Tan | Species: human | Application: WB - Indole modulates lipoteichoic acid-induced inflammatory response in duck intestinal epithelial cells
Journal: Microb Pathog | Authors: Wei Yan | Application: WB - Bilobalide alleviates ischemia-reperfusion injury during liver transplantation by regulating macrophage polarization through inhibiting NF-κB pathway.
Journal: Hepatobiliary Pancreat Dis Int | Authors: Yi-Xiao Tang | Species: rat | Application: WB,IHC,IF - Exploring the effects of lactulose on lung-intestinal tissue-associated factors and the TLR4/NF-κB signaling pathway in COPD rats based on lung-gut axis theory
Journal: Microb Pathog | Authors: Xinyuan Liu | Species: rat - Combined treatment with glucosamine and chondroitin sulfate improves rheumatoid arthritis in rats by regulating the gut microbiota
Journal: Nutr Metab (Lond) | Authors: Xuesong Wang | Species: rat | Application: IHC - Exploring the effects of lactulose on lung-intestinal tissue-associated factors and the TLR4/NF-κB signaling pathway in COPD rats based on lung-gut axis theory
Journal: Microb Pathog | Authors: Xinyuan Liu | Species: rat - Methionine strengthens anti-inflammation of rice protein via depressing NF-κB activation and stimulating Msr expression in rats fed cholesterol-enriched diets.
Journal: Food Sci Biotechnol | Authors: Zhengxuan Wang | Species: rat | Application: WB - Morchella esculenta polysaccharide attenuate obesity, inflammation and modulate gut microbiota
Journal: AMB Express | Authors: Ata Ur Rehman | Species: mouse | Application: WB - HMGB1 Mediates Paraquat-Induced Neuroinflammatory Responses via Activating RAGE Signaling Pathway.
Journal: Neurotox Res | Authors: Min Huang | Species: human | Application: WB - Protective effects of Curcumin-Zinc complex on inflammatory damage of IPEC-J2 cells induced by bacterial lipopolysaccharide.
Journal: AMB Express | Authors: Xiaopeng Tang | Species: pig | Application: WB - Methionine strengthens anti-inflammation of rice protein via depressing NF-κB activation and stimulating Msr expression in rats fed cholesterol-enriched diets.
Journal: Food Sci Biotechnol | Authors: Zhengxuan Wang | Species: rat | Application: WB - Paeonol ameliorates CFA-induced inflammatory pain by inhibiting HMGB1/TLR4/NF-κB p65 pathway.
Journal: Metab Brain Dis | Authors: Chen Qiu | Species: mouse | Application: WB - Mechanisms by which SIRT2 modulates alveolar macrophage immunoreactivity to intervene in Actinobacillus pleuropneumoniae infection in piglets under cold stimulation.
Journal: Vet Res | Authors: Rongge Xia | Species: pig | Application: WB - Xanthoxylin Regulating the Inflammatory Microenvironment After Spinal Cord Injury Through Inhibition of the NF-κB Signaling Pathway.
Journal: Neuromolecular Med | Authors: Zihao Fan | Species: mouse | Application: WB - An engineered antimicrobial peptide Z-FV7 demonstrates bactericidal efficacy against multidrug-resistant Escherichia coli in a murine model of endometritis
Journal: Vet Res | Authors: Jieru Su | Species: mouse,bovine | Application: WB - Synergistic proanthocyanidin-copper oxygen-generating microneedle enhances anti-inflammatory activity in dental pulp stem cells and macrophage efferocytosis.
Journal: BMC Oral Health | Authors: Yating Miao | Species: human | Application: WB - Ginkgetin delays the progression of osteoarthritis by inhibiting the NF-κB and MAPK signaling pathways
Journal: J Orthop Surg Res | Authors: Liang Zhu | Species: human | Application: WB - The haemagglutinin-neuraminidase protein of velogenic Newcastle disease virus enhances viral infection through NF-κB-mediated programmed cell death
Journal: Vet Res | Authors: Xiaolong Lu | Application: WB - MicroRNA miR-223 modulates NLRP3 and Keap1, mitigating lipopolysaccharide-induced inflammation and oxidative stress in bovine mammary epithelial cells and murine mammary glands
Journal: Vet Res | Authors: Man Zhou | Species: bovine | Application: WB - Effects of chronic social defeat stress on behavior and cognition by activating the ERS-NLRP3 signaling pathway in adult mice.
Journal: Metab Brain Dis | Authors: XiaoLei Gao | Species: mouse | Application: WB - Gut microbiota: A critical regulator of oxaliplatin-induced peripheral neurotoxicity development.
Journal: Neurotoxicology | Authors: Zhen Liu | Species: rat | Application: WB,IF - Pseudorabies Virus Tegument Protein UL13 Suppresses RLR-Mediated Antiviral Innate Immunity through Regulating Receptor Transcription.
Journal: Viruses | Authors: Ningning Zhao | Species: human | Application: WB - CDGSH iron sulfur domain 2 mitigates apoptosis, oxidative stress and inflammatory response caused by oxygen-glucose deprivation/reoxygenation in HT22 hippocampal neurons by Akt-Nrf2-activated pathway
Journal: Metab Brain Dis | Authors: Xiaoyan Ren | Species: mouse | Application: WB - Resveratrol inhibits the progression of premature senescence partially by regulating v-rel avian reticuloendotheliosis viral oncogene homolog A (RELA) and sirtuin 1 (SIRT1).
Journal: Ren Fail | Authors: Shuangjun He | Species: human | Application: WB - Synergistic proanthocyanidin-copper oxygen-generating microneedle enhances anti-inflammatory activity in dental pulp stem cells and macrophage efferocytosis.
Journal: BMC Oral Health | Authors: Yating Miao | Species: human | Application: WB - Targeting ICAM1 through LIF-mediated NF-κB/JAK2-STAT3 crosstalk protects nucleus pulposus from IL-1β-driven pyroptosis to ameliorate intervertebral disc degeneration.
Journal: J Orthop Surg Res | Authors: Zhen Wang | Species: human | Application: WB - Grape seed-derived procyanidins decreases neuropathic pain and nerve regeneration by suppression of TLR4-Myd88 signaling
Journal: Mol Pain | Authors: Li Hu | Species: rat | Application: IHC - Xanthoxylin Regulating the Inflammatory Microenvironment After Spinal Cord Injury Through Inhibition of the NF-κB Signaling Pathway.
Journal: Neuromolecular Med | Authors: Zihao Fan | Species: mouse | Application: WB - An engineered antimicrobial peptide Z-FV7 demonstrates bactericidal efficacy against multidrug-resistant Escherichia coli in a murine model of endometritis
Journal: Vet Res | Authors: Jieru Su | Species: mouse,bovine | Application: WB - Synergistic proanthocyanidin-copper oxygen-generating microneedle enhances anti-inflammatory activity in dental pulp stem cells and macrophage efferocytosis.
Journal: BMC Oral Health | Authors: Yating Miao | Species: human | Application: WB - The haemagglutinin-neuraminidase protein of velogenic Newcastle disease virus enhances viral infection through NF-κB-mediated programmed cell death
Journal: Vet Res | Authors: Xiaolong Lu | Application: WB - Crosstalk between adipocytes and M2 macrophages compensates for osteopenic phenotype in the Lrp5-deficient mice.
Journal: Exp Biol Med (Maywood) | Authors: Lisha Li | Species: mouse | Application: WB - Porcine Circovirus Type 2 Induces Single Immunoglobulin Interleukin-1 Related Receptor (SIGIRR) Downregulation to Promote Interleukin-1β Upregulation in Porcine Alveolar Macrophage.
Journal: Viruses | Authors: Shunli Yang | Species: pig | Application: WB - Gut microbiota: A critical regulator of oxaliplatin-induced peripheral neurotoxicity development.
Journal: Neurotoxicology | Authors: Zhen Liu | Species: rat | Application: WB,IF - Porcine Circovirus Type 2 Induces Single Immunoglobulin Interleukin-1 Related Receptor (SIGIRR) Downregulation to Promote Interleukin-1β Upregulation in Porcine Alveolar Macrophage.
Journal: Viruses | Authors: Shunli Yang | Species: pig | Application: WB - Pseudorabies Virus ICP0 Abolishes Tumor Necrosis Factor Alpha-Induced NF-κB Activation by Degrading P65.
Journal: Viruses | Authors: Xiangbo Zhang | Species: pig | Application: WB,IP - Guanosine and uridine alleviate airway inflammation via inhibition of the MAPK and NF-κB signals in OVA-induced asthmatic mice.
Journal: Pulm Pharmacol Ther | Authors: Yujiao Luo | Species: mouse,human | Application: WB - Ginkgetin delays the progression of osteoarthritis by inhibiting the NF-κB and MAPK signaling pathways
Journal: J Orthop Surg Res | Authors: Liang Zhu | Species: human | Application: WB - Gut microbiota: A critical regulator of oxaliplatin-induced peripheral neurotoxicity development.
Journal: Neurotoxicology | Authors: Zhen Liu | Species: rat | Application: WB,IF - Regorafenib suppresses epidermal growth factor receptor signaling-modulated progression of colorectal cancer.
Journal: Biomed Pharmacother | Authors: Yu-Chang Liu | Species: human | Application: WB - Tannic acid ameliorates arsenic trioxide-induced nephrotoxicity, contribution of NF-κB and Nrf2 pathways.
Journal: Biomed Pharmacother | Authors: Weiyue Jin | Species: rat | Application: WB - Network pharmacology based research into the effect and mechanism of Xijiao Dihuang decoction against sepsis.
Journal: Biomed Pharmacother | Authors: Jun Lu | Species: rat | Application: WB - Ruscogenin alleviates LPS-induced pulmonary endothelial cell apoptosis by suppressing TLR4 signaling.
Journal: Biomed Pharmacother | Authors: Yunhao Wu | Species: mouse | Application: WB,IF - Regorafenib suppresses epidermal growth factor receptor signaling-modulated progression of colorectal cancer.
Journal: Biomed Pharmacother | Authors: Yu-Chang Liu | Species: human | Application: WB - IFI16 promotes cervical cancer progression by upregulating PD-L1 in immunomicroenvironment through STING-TBK1-NF-kB pathway.
Journal: Biomed Pharmacother | Authors: Hongning Cai | Species: human | Application: WB - SALL1 promotes proliferation and metastasis and activates phosphorylation of p65 and JUN in colorectal cancer cells
Journal: Pathol Res Pract | Authors: Jie Yuan | Species: human | Application: WB - SIRT7: A potential prognostic marker and therapeutic target in gallbladder cancer
Journal: Pathol Res Pract | Authors: Bo Xu | Species: human | Application: WB,IF - DNA virus oncoprotein HPV18 E7 selectively antagonizes cGAS-STING-triggered innate immune activation
Journal: J Med Virol | Authors: Meng Lou | Species: human | Application: WB - FNDC5 inhibits foam cell formation and monocyte adhesion in vascular smooth muscle cells via suppressing NFκB-mediated NLRP3 upregulation.
Journal: Vascul Pharmacol | Authors: Ying-Hao Zang | Application: WB - The mechanism underlying ICAM-1 and E-selectin-mediated hypertriglyceridemic pancreatitis-associated lung injury
Journal: Mol Immunol | Authors: Rong Yu | Species: mouse | Application: WB - MiR-23b-3p alleviates Sjögren's syndrome by targeting SOX6 and inhibiting the NF-κB signaling
Journal: Mol Immunol | Authors: Yan Cai | Species: mouse | Application: WB - TRAIL facilitates cytokine expression and macrophage migration during hypoxia/reoxygenation via ER stress-dependent NF-κB pathway.
Journal: Mol Immunol | Authors: Yinan Jiang | Species: rat | Application: WB - DNA virus oncoprotein HPV18 E7 selectively antagonizes cGAS-STING-triggered innate immune activation
Journal: J Med Virol | Authors: Meng Lou | Species: human | Application: WB - TBK1 participates in glutaminolysis by mediating the phosphorylation of RIPK3 to promote endotoxin tolerance.
Journal: Mol Immunol | Authors: Lehan Pan | Species: mouse | Application: WB - Synthesis of Lathyrol PROTACs and Evaluation of Their Anti-Inflammatory Activities
Journal: J Nat Prod | Authors: Wang Wang | Species: mouse | Application: WB - ADAP2 drives immune-associated progression of esophageal cancer and serves as a potential therapeutic target.
Journal: Pathol Res Pract | Authors: Xiangkun Du - SALL1 promotes proliferation and metastasis and activates phosphorylation of p65 and JUN in colorectal cancer cells
Journal: Pathol Res Pract | Authors: Jie Yuan | Species: human | Application: WB - The mechanism underlying ICAM-1 and E-selectin-mediated hypertriglyceridemic pancreatitis-associated lung injury
Journal: Mol Immunol | Authors: Rong Yu | Species: mouse | Application: WB - Effects of resveratrol and its derivative pterostilbene on hepatic injury and immunological stress of weaned piglets challenged with lipopolysaccharide
Journal: J Anim Sci | Authors: Yue Li | Species: mouse | Application: WB,IF - Phosphocreatine protects endothelial cells from Methylglyoxal induced oxidative stress and apoptosis via the regulation of PI3K/Akt/eNOS and NF-қB pathway.
Journal: Vascul Pharmacol | Authors: Peng Chu | Species: human | Application: WB - SALL1 promotes proliferation and metastasis and activates phosphorylation of p65 and JUN in colorectal cancer cells
Journal: Pathol Res Pract | Authors: Jie Yuan | Species: human | Application: WB - SIRT7: A potential prognostic marker and therapeutic target in gallbladder cancer
Journal: Pathol Res Pract | Authors: Bo Xu | Species: human | Application: WB,IF - TBK1 participates in glutaminolysis by mediating the phosphorylation of RIPK3 to promote endotoxin tolerance.
Journal: Mol Immunol | Authors: Lehan Pan | Species: mouse | Application: WB - M2 macrophages promote PD-L1 expression in triple-negative breast cancer via secreting CXCL1
Journal: Pathol Res Pract | Authors: Lifen Zhang | Species: human - Resveratrol Alleviates Liver Fibrosis by Targeting Cross-Talk Between TLR2/MyD88/ERK and NF-κB/NLRP3 Inflammasome Pathways in Macrophages
Journal: J Biochem Mol Toxicol | Authors: Jin-Qing Lei | Species: mouse | Application: IF - Astragaloside IV Alleviates Cisplatin Chemotherapy-Induced Nephrotoxicity via Modulation of Nrf2/HO-1/NF-κB Pathway and Reversal of EMT Process.
Journal: J Biochem Mol Toxicol | Authors: Xiaoyun Ding | Species: mouse | Application: WB - Extracellular vesicles from Li-Qi-Yang-Yin formula attenuate LPS-stimulated inflammatory injury in human colonic epithelial cells in vitro by delivering bioactive metabolites and suppressing the oxidative stress-inflammation axis.
Journal: Front Med (Lausanne) | Authors: Xiaoyue Deng | Species: human | Application: WB - Allograft inflammatory factor-1 enhances inflammation and oxidative stress via the NF-κB pathway of bladder urothelium in diabetic rat model
Journal: Cytokine | Authors: Qinguo Wu | Species: human | Application: WB,IF - Linderalactone mitigates diabetic renal injury by inhibiting macrophage inflammation via the Dectin1/Syk/CARD9/IRF5/NF-κB pathway.
Journal: J Diabetes Investig | Authors: Hao Chen | Species: mouse | Application: WB,IF - Salvianolic acid A preconditioning confers protection against concanavalin A-induced liver injury through SIRT1-mediated repression of p66shc in mice.
Journal: Toxicol Appl Pharmacol | Authors: Xu Xiaomei X | Species: mouse | Application: WB - Resveratrol Alleviates Liver Fibrosis by Targeting Cross-Talk Between TLR2/MyD88/ERK and NF-κB/NLRP3 Inflammasome Pathways in Macrophages
Journal: J Biochem Mol Toxicol | Authors: Jin-Qing Lei | Species: mouse | Application: IF - Palovarotene Can Attenuate Heterotopic Ossification Induced by Tendon Stem Cells by Downregulating the Synergistic Effects of Smad and NF-κB Signaling Pathway following Stimulation of the Inflammatory Microenvironment.
Journal: Stem Cells Int | Authors: Junchao Huang | Species: rat | Application: IHC,IF - Linderalactone mitigates diabetic renal injury by inhibiting macrophage inflammation via the Dectin1/Syk/CARD9/IRF5/NF-κB pathway.
Journal: J Diabetes Investig | Authors: Hao Chen | Species: mouse | Application: WB,IF - Extracellular vesicles from Li-Qi-Yang-Yin formula attenuate LPS-stimulated inflammatory injury in human colonic epithelial cells in vitro by delivering bioactive metabolites and suppressing the oxidative stress-inflammation axis.
Journal: Front Med (Lausanne) | Authors: Xiaoyue Deng | Species: human | Application: WB - Evolutionary history and functional characterization of Lj-TICAM-a and Lj-TICAM-b formed via lineage-specific tandem duplication in lamprey (Lampetra japonica).
Journal: Genomics | Authors: Ming Geng | Species: human | Application: WB - Artemisinin alleviates cardiac and cerebral injury after cardiopulmonary resuscitation in pigs by regulating the HMGB1/TLR4/NF-κB mediated inflammatory pathway.
Journal: Toxicol Appl Pharmacol | Authors: Licai Liang | Species: pig | Application: WB - β-Sitosterol Ameliorates Ulcerative Colitis Through Modulation of the AMPK/MLCK Anti-Inflammatory Pathway
Journal: J Biochem Mol Toxicol | Authors: Yuansen Zhang | Species: mouse | Application: WB - Artemisinin alleviates cardiac and cerebral injury after cardiopulmonary resuscitation in pigs by regulating the HMGB1/TLR4/NF-κB mediated inflammatory pathway.
Journal: Toxicol Appl Pharmacol | Authors: Licai Liang | Species: pig | Application: WB - Xiao-Jie-An Capsule Attenuates Oestrogen- and Progestogen-Induced Mammary Gland Hyperplasia by Modulating Sex Hormone Levels and Reducing Inflammatory Response.
Journal: Basic Clin Pharmacol Toxicol | Authors: Kecheng Tang | Species: rat | Application: WB - Resveratrol Alleviates Liver Fibrosis by Targeting Cross-Talk Between TLR2/MyD88/ERK and NF-κB/NLRP3 Inflammasome Pathways in Macrophages
Journal: J Biochem Mol Toxicol | Authors: Jin-Qing Lei | Species: mouse | Application: IF - Extracellular vesicles from Li-Qi-Yang-Yin formula attenuate LPS-stimulated inflammatory injury in human colonic epithelial cells in vitro by delivering bioactive metabolites and suppressing the oxidative stress-inflammation axis.
Journal: Front Med (Lausanne) | Authors: Xiaoyue Deng | Species: human | Application: WB - Investigation on the Pathological Mechanism of Frequent Exacerbators With Chronic Obstructive Pulmonary Disease Based on the Characteristics of Respiratory Flora.
Journal: Front Med (Lausanne) | Authors: Li Ke | Species: human | Application: WB - Multi-targeted inhibition of NF-κB signaling underlies the anti-osteoarthritic effects of BGJXF and its key component dehydrocorydaline.
Journal: Front Med (Lausanne) | Authors: Jingyu Shen | Species: human | Application: WB - Extracellular vesicles from Li-Qi-Yang-Yin formula attenuate LPS-stimulated inflammatory injury in human colonic epithelial cells in vitro by delivering bioactive metabolites and suppressing the oxidative stress-inflammation axis.
Journal: Front Med (Lausanne) | Authors: Xiaoyue Deng | Species: human | Application: WB - Xiao-Jie-An Capsule Attenuates Oestrogen- and Progestogen-Induced Mammary Gland Hyperplasia by Modulating Sex Hormone Levels and Reducing Inflammatory Response.
Journal: Basic Clin Pharmacol Toxicol | Authors: Kecheng Tang | Species: rat | Application: WB - Astragaloside IV Alleviates Cisplatin Chemotherapy-Induced Nephrotoxicity via Modulation of Nrf2/HO-1/NF-κB Pathway and Reversal of EMT Process.
Journal: J Biochem Mol Toxicol | Authors: Xiaoyun Ding | Species: mouse | Application: WB - β-Sitosterol Ameliorates Ulcerative Colitis Through Modulation of the AMPK/MLCK Anti-Inflammatory Pathway
Journal: J Biochem Mol Toxicol | Authors: Yuansen Zhang | Species: mouse | Application: WB - Gentiopicroside Attenuated Dopaminergic Neurodegeneration via Inhibiting Neuroinflammatory Responses and Ferroptosis in Experimental Models of Parkinson's Disease
Journal: Basic Clin Pharmacol Toxicol | Authors: Fangling Sun | Species: rat,human | Application: WB - Linderalactone mitigates diabetic renal injury by inhibiting macrophage inflammation via the Dectin1/Syk/CARD9/IRF5/NF-κB pathway.
Journal: J Diabetes Investig | Authors: Hao Chen | Species: mouse | Application: WB,IF - Gentiopicroside Attenuated Dopaminergic Neurodegeneration via Inhibiting Neuroinflammatory Responses and Ferroptosis in Experimental Models of Parkinson's Disease
Journal: Basic Clin Pharmacol Toxicol | Authors: Fangling Sun | Species: rat,human | Application: WB - Evolutionary history and functional characterization of Lj-TICAM-a and Lj-TICAM-b formed via lineage-specific tandem duplication in lamprey (Lampetra japonica).
Journal: Genomics | Authors: Ming Geng | Species: human | Application: WB - M2 macrophage-derived paracrine factor TNFSF13 affects the fibrogenic alterations in endothelial cells and cardiac fibroblasts by mediating the NF-κB and Akt pathway
Journal: J Biochem Mol Toxicol | Authors: Xiaoli Tan | Species: human | Application: WB - Artemisinin alleviates cardiac and cerebral injury after cardiopulmonary resuscitation in pigs by regulating the HMGB1/TLR4/NF-κB mediated inflammatory pathway.
Journal: Toxicol Appl Pharmacol | Authors: Licai Liang | Species: pig | Application: WB - Lixisenatide ameliorated lipopolysaccharide (LPS)-induced expression of mucin and inflammation in bronchial epithelial cells
Journal: J Biochem Mol Toxicol | Authors: Leiming Xu | Species: human | Application: WB - Investigation on the Pathological Mechanism of Frequent Exacerbators With Chronic Obstructive Pulmonary Disease Based on the Characteristics of Respiratory Flora.
Journal: Front Med (Lausanne) | Authors: Li Ke | Species: human | Application: WB - Inhibition of microRNA-143-3p attenuates myocardial hypertrophy by inhibiting inflammatory response.
Journal: Cell Biol Int | Authors: Bo Yu | Species: rat | Application: WB - Tanshinone IIA Promoted Autophagy and Inhibited Inflammation to Alleviate Podocyte Injury in Diabetic Nephropathy
Journal: Diabetes Metab Syndr Obes | Authors: Yuan Li | Species: mouse | Application: WB,IF - ZACN Associated with Poor Prognosis Promotes Proliferation of Kidney Renal Clear Cell Carcinoma Cells by Inhibiting JTC801-Induced Alkaliptosis
Journal: Appl Biochem Biotechnol | Authors: Yifan Li | Species: human | Application: WB - Grifola frondosa Polysaccharide Ameliorates Early Diabetic Nephropathy by Suppressing the TLR4/NF-κB Pathway.
Journal: Appl Biochem Biotechnol | Authors: Tao Jiang | Species: rat | Application: WB - Kaempferitrin Attenuates Lipopolysaccharide-Induced Cardiac Dysfunction Through Suppression of the NF-κB/NLRP3 Signaling Pathway.
Journal: Immun Inflamm Dis | Authors: Hongyu Kuang | Species: mouse | Application: WB - Gastrodin protects against high glucose-induced cardiomyocyte toxicity via GSK-3β-mediated nuclear translocation of Nrf2.
Journal: Hum Exp Toxicol | Authors: Z Dong | Species: mouse | Application: WB - Fu-Fang-Qi-Di-Hua-Yu-Tang Improves Diabetic Macrovascular Disease via PI3K/AKT Pathway Regulation.
Journal: Diabetes Metab Syndr Obes | Authors: Shizhao Zhang | Species: mouse | Application: WB - Differential Effects of Saturated and Unsaturated Fatty Acids on Colorectal Cancer via IDO1 Signaling.
Journal: Cancer Med | Authors: Shulin Zhang | Species: human | Application: WB - SIRT5 alleviates hepatic ischemia and reperfusion injury by diminishing oxidative stress and inflammation via elevating SOD1 and IDH2 expression
Journal: Exp Cell Res | Authors: Daofeng Zheng | Species: mouse | Application: WB - 4-(5'-Dimethylamino)-Naphthalenesulfonyl-2(3H)-Benzoxazolone (W3D) Ameliorated COPD Lung Injury Through Regulating Macrophage Polarization Mediated by Glycolysis.
Journal: Arch Pharm (Weinheim) | Authors: Qikai Su | Species: human | Application: WB - Inhibition of microRNA-143-3p attenuates myocardial hypertrophy by inhibiting inflammatory response.
Journal: Cell Biol Int | Authors: Bo Yu | Species: rat | Application: WB - ShenmaYizhi Decoction Improves the Mitochondrial Structure in the Brain and Ameliorates Cognitive Impairment in VCI Rats via the AMPK/UCP2 Signaling Pathway.
Journal: Neuropsychiatr Dis Treat | Authors: Chengcheng Sun | Species: mouse | Application: WB - TIPE2 aggravates experimental colitis and disrupts intestinal epithelial barrier integrity by activating JAK2/STAT3/SOCS3 signal pathway
Journal: Exp Cell Res | Authors: Lingli Zeng | Application: WB - Kaempferitrin Attenuates Lipopolysaccharide-Induced Cardiac Dysfunction Through Suppression of the NF-κB/NLRP3 Signaling Pathway.
Journal: Immun Inflamm Dis | Authors: Hongyu Kuang | Species: mouse | Application: WB - Tanshinone IIA Promoted Autophagy and Inhibited Inflammation to Alleviate Podocyte Injury in Diabetic Nephropathy
Journal: Diabetes Metab Syndr Obes | Authors: Yuan Li | Species: mouse | Application: WB,IF - Pyridostigmine attenuates placental-ischemia-upregulated placental angiotensin II type 1 receptor in rats.
Journal: Peptides | Authors: Abdoulaye Issotina Zibrila | Species: rat | Application: WB - Pseudogene CLEC4GP1 modulates trophoblast cell apoptosis and invasion via IL-15 inhibition.
Journal: Exp Cell Res | Authors: Ailan Yin | Species: human | Application: IHC - AEBP1, a prognostic indicator, promotes colon adenocarcinoma cell growth and metastasis through the NF-κB pathway.
Journal: Mol Carcinog | Authors: Yanwei Xing | Species: human | Application: WB - GDF15 induced by compressive force contributes to osteoclast differentiation in human periodontal ligament cells.
Journal: Exp Cell Res | Authors: Shuo Li | Species: human | Application: WB - Protection of seven dibenzocyclooctadiene lignans from Schisandra chinensis against serum and glucose deprivation injury in SH-SY5Y cells.
Journal: Cell Biol Int | Authors: Qun E - (R)-bambuterol ameliorates DSS-induced colitis in mice fed a high-fat diet via modulating immune response, intestinal barrier integrity, gut microbiota, and metabolomic profiles.
Journal: Arch Biochem Biophys | Authors: Liangjun Deng | Species: mouse | Application: WB - Mechanism of HAND2 Regulating Glycolytic Metabolism and Metastasis Through TLR4/NOX2/DUOX2 Signaling Axis in Cervical Cancer.
Journal: Mol Carcinog | Authors: Hansheng Yang | Species: human | Application: WB - Novel c-Myc G4 stabilizer EP12 promotes myeloma cytotoxicity by disturbing NF-κB signaling
Journal: Exp Cell Res | Authors: Ruosi Yao | Species: human | Application: WB,IF - Inhibition of microRNA-143-3p attenuates myocardial hypertrophy by inhibiting inflammatory response.
Journal: Cell Biol Int | Authors: Bo Yu | Species: rat | Application: WB - GDF15 induced by compressive force contributes to osteoclast differentiation in human periodontal ligament cells.
Journal: Exp Cell Res | Authors: Shuo Li | Species: human | Application: WB - Novel c-Myc G4 stabilizer EP12 promotes myeloma cytotoxicity by disturbing NF-κB signaling
Journal: Exp Cell Res | Authors: Ruosi Yao | Species: human | Application: WB,IF - SPOP inhibits mice pancreatic stellate cell activation by promoting FADD degradation in cerulein-induced chronic pancreatitis.
Journal: Exp Cell Res | Authors: Peng Tan | Species: mouse | Application: WB - Mechanism of HAND2 Regulating Glycolytic Metabolism and Metastasis Through TLR4/NOX2/DUOX2 Signaling Axis in Cervical Cancer.
Journal: Mol Carcinog | Authors: Hansheng Yang | Species: human | Application: WB - TIPE2 aggravates experimental colitis and disrupts intestinal epithelial barrier integrity by activating JAK2/STAT3/SOCS3 signal pathway
Journal: Exp Cell Res | Authors: Lingli Zeng | Application: WB - Tanshinone IIA Promoted Autophagy and Inhibited Inflammation to Alleviate Podocyte Injury in Diabetic Nephropathy
Journal: Diabetes Metab Syndr Obes | Authors: Yuan Li | Species: mouse | Application: WB,IF - ZFP36 and CEBPA are macrophage-associated prognostic biomarkers linked to glomerular endothelial inflammation in ANCA-associated glomerulonephritis.
Journal: Exp Cell Res | Authors: Anqi Ni | Species: human | Application: WB - Grifola frondosa Polysaccharide Ameliorates Early Diabetic Nephropathy by Suppressing the TLR4/NF-κB Pathway.
Journal: Appl Biochem Biotechnol | Authors: Tao Jiang | Species: rat | Application: WB - PSAT1 Promotes NSCLC Progression via the De Novo Serine Synthesis Pathway and Represents a Therapeutic Vulnerability.
Journal: Cancer Med | Authors: Xijia Zhou | Species: human | Application: WB - Tumor necrosis factor α-induced protein 8-like-2 controls microglia phenotype via metabolic reprogramming in BV2 microglial cells and responses to neuropathic pain
Journal: Int J Biochem Cell Biol | Authors: Yeqi Li | Species: mouse | Application: WB - Toll-like receptor 4 shRNA attenuates lipopolysaccharide-induced epithelial-mesenchymal transition of intrahepatic biliary epithelial cells in rats.
Journal: Biomed Pharmacother | Authors: Shifang Tang | Species: rat | Application: WB - Toll-like receptor 4 shRNA attenuates lipopolysaccharide-induced epithelial-mesenchymal transition of intrahepatic biliary epithelial cells in rats.
Journal: Biomed Pharmacother | Authors: Shifang Tang | Species: rat | Application: WB - Caffeic acid protects against IL-1β-induced inflammatory responses and cartilage degradation in articular chondrocytes.
Journal: Biomed Pharmacother | Authors: Xiaojian Huang | Species: rat | Application: WB - Neuroprotective Effects of the Sonic Hedgehog Signaling Pathway in Ischemic Injury through Promotion of Synaptic and Neuronal Health.
Journal: Neural Plast | Authors: Sen Yin | Species: mouse | Application: WB - NR2C2 of macrophages promotes inflammation via NF-κB in LPS-induced orchitis in mice
Journal: Reproduction | Authors: Ziqian Min | Species: mouse | Application: WB - SPNS2 Downregulation Induces EMT and Promotes Colorectal Cancer Metastasis via Activating AKT Signaling Pathway.
Journal: Front Oncol | Authors: Lei Lv | Species: human | Application: WB - Inhibitory effect of hydroxychloroquine on glucocorticoid-induced osteoporosis in lupus therapy
Journal: Clin Transl Immunology | Authors: Wenlin Qiu | Species: mouse | Application: WB - Diterpenoid alkaloids from Delphinium forrestii var. viride and their anti-inflammation activity.
Journal: Phytochemistry | Authors: Zhuorui Song | Species: mouse | Application: WB,IF - Protective Effects of Ginseng Soluble Dietary Fiber and Its Fecal Microbiota Extract on Antibiotic-Induced Gut Dysbiosis Obese Mice
Journal: J Microbiol Biotechnol | Authors: Luran Yang | Species: mouse | Application: WB - The Gut Microbiota of Pregnant Rats Alleviates Fetal Growth Restriction by Inhibiting the TLR9/MyD88 Pathway
Journal: J Microbiol Biotechnol | Authors: Hui Tang | Species: human | Application: WB - Diterpenoids with anti-inflammatory activity from Euphorbia wallichii
Journal: Phytochemistry | Authors: Yali Wang | Species: mouse | Application: WB,IF - Ginsenoside Compound K Plays an Anti-Inflammatory Role in Gingival Epithelial Cells Stimulated With Porphyromonas gingivalis by Regulating Pyruvate Kinase M2.
Journal: Mol Oral Microbiol | Authors: Luxin Jin | Species: human | Application: WB - Scorpion Venom Analgesic Peptide, BmK AGAP Inhibits Stemness, and Epithelial-Mesenchymal Transition by Down-Regulating PTX3 in Breast Cancer.
Journal: Front Oncol | Authors: Sylvanus Kampo | Species: human | Application: WB,IHC - The Combination of Bacillus natto JLCC513 and Ginseng Soluble Dietary Fiber Attenuates Ulcerative Colitis by Modulating the LPS/TLR4/NF-κB Pathway and Gut Microbiota
Journal: J Microbiol Biotechnol | Authors: Mingyue Ma | Species: mouse | Application: WB - Ginsenoside Compound K Plays an Anti-Inflammatory Role in Gingival Epithelial Cells Stimulated With Porphyromonas gingivalis by Regulating Pyruvate Kinase M2.
Journal: Mol Oral Microbiol | Authors: Luxin Jin | Species: human | Application: WB - Evaluation of Cytoprotective Effects of Cannabidiol on Neuroinflammation and Neurogenesis Process in Rat Offsprings
Journal: Reprod Toxicol | Authors: Deniz Catakli | Species: rat | Application: WB - Silencing of LncRNA Steroid Receptor RNA Activator attenuates polycystic ovary syndrome in Mice.
Journal: Biochimie | Authors: Yan Li | Species: mouse | Application: WB,IF - Rhodotorula mucilaginosa JAASSRY1 Ameliorates Cyclophosphamide-Induced Immunosuppression by Regulating Gut Microbiota and Activation of Spleen TLR4/MyD88/NF-κB Pathway.
Journal: J Microbiol Biotechnol | Authors: Min Yang | Species: mouse | Application: WB,IF - Prevotella copri Exacerbates Psoriasis Through Keratinocyte-Neutrophil Crosstalk via NF-κB Activation.
Journal: Exp Dermatol | Authors: Meijunzi Luo - Role of Protein Tyrosine Phosphatase 1B Inhibitor in Early Brain Injury of Subarachnoid Hemorrhage in Mice
Journal: Brain Sci | Authors: Zhong-Hua Zhang | Species: Mouse | Application: WB - Differential apoptosis of GES-1 cells induced by Helicobacter pylori with heteroresistance to clarithromycin.
Journal: Arch Microbiol | Authors: Xue Wang | Species: human | Application: WB - SPNS2 Downregulation Induces EMT and Promotes Colorectal Cancer Metastasis via Activating AKT Signaling Pathway.
Journal: Front Oncol | Authors: Lei Lv | Species: human | Application: WB - Prevotella copri Exacerbates Psoriasis Through Keratinocyte-Neutrophil Crosstalk via NF-κB Activation.
Journal: Exp Dermatol | Authors: Meijunzi Luo - CALR-TLR4 Complex Inhibits Non-Small Cell Lung Cancer Progression by Regulating the Migration and Maturation of Dendritic Cells.
Journal: Front Oncol | Authors: Ruo Chen | Species: human | Application: WB - Icariin reduces cognitive dysfunction induced by surgical trauma in aged rats by inhibiting hippocampal neuroinflammation
Journal: Front Behav Neurosci | Authors: Lifeng Wang | Species: rat | Application: WB - The Gut Microbiota of Pregnant Rats Alleviates Fetal Growth Restriction by Inhibiting the TLR9/MyD88 Pathway
Journal: J Microbiol Biotechnol | Authors: Hui Tang | Species: human | Application: WB - Silencing of LncRNA Steroid Receptor RNA Activator attenuates polycystic ovary syndrome in Mice.
Journal: Biochimie | Authors: Yan Li | Species: mouse | Application: WB,IF - Scorpion Venom Analgesic Peptide, BmK AGAP Inhibits Stemness, and Epithelial-Mesenchymal Transition by Down-Regulating PTX3 in Breast Cancer.
Journal: Front Oncol | Authors: Sylvanus Kampo | Species: human | Application: WB,IHC - Inhibitory effect of hydroxychloroquine on glucocorticoid-induced osteoporosis in lupus therapy
Journal: Clin Transl Immunology | Authors: Wenlin Qiu | Species: mouse | Application: WB - MG132-mediated inhibition of the ubiquitin-proteasome pathway ameliorates cancer cachexia.
Journal: J Cancer Res Clin Oncol | Authors: Zhang Liuping L | Species: mouse | Application: WB - Macrophage regulator of G-protein signaling 12 contributes to inflammatory pain hypersensitivity.
Journal: Ann Transl Med | Authors: Gongsheng Yuan | Species: mouse | Application: WB - GM1 Ameliorates Neuronal Injury in Rats after Cerebral Ischemia and Reperfusion: Potential Contribution of Effects on SPTBN1-mediated Signaling.
Journal: Neuroscience | Authors: Yun-Wei Shi | Species: rat | Application: WB - Caffeic acid-grafted chitooligosaccharides downregulate MAPK and NF-kB in RAW264.7 cells
Journal: Chem Biol Drug Des | Authors: Van-Hoai Bui | Species: mouse | Application: WB - Cysteinyl Leukotriene Receptor 2 is Involved in Inflammation and Neuronal Damage by Mediating Microglia M1/M2 Polarization through NF-κB Pathway.
Journal: Neuroscience | Authors: Rui Zhao | Species: human | Application: WB - Ginkgetin Attenuates Dextran Sulfate Sodium-Induced Colitis by Inhibiting the Nuclear Factor Kappa B Pathway.
Journal: Chem Biol Drug Des | Authors: Xuejing Qiao | Species: human | Application: IF - The Role of the Negative Regulation of Microglia-Mediated Neuroinflammation in Improving Emotional Behavior After Epileptic Seizures.
Journal: Front Neurol | Authors: Qiong Wu | Species: rat | Application: WB,IF - Microglial activation and over pruning involved in developmental epilepsy
Journal: J Neuropathol Exp Neurol | Authors: Qiong Wu | Species: rat | Application: IF - Ginkgetin Attenuates Dextran Sulfate Sodium-Induced Colitis by Inhibiting the Nuclear Factor Kappa B Pathway.
Journal: Chem Biol Drug Des | Authors: Xuejing Qiao | Species: human | Application: IF - MiR-519d-5p modulates the sensitivity of breast cancer to chemotherapy by forming a negative feedback loop with RELA.
Journal: Ann Transl Med | Authors: Ding Li | Species: human | Application: WB - Comparisons of the Effects of Low- or High-Fat Diets Rich in Soybean Oil, Lard, and Tea Seed Oil on Markers of Blood-Brain Barrier and Neuroinflammation in Ovariectomized Mice.
Journal: Int J Food Sci | Authors: Shyh-Hsiang Lin | Species: mouse | Application: WB - Cysteinyl Leukotriene Receptor 2 is Involved in Inflammation and Neuronal Damage by Mediating Microglia M1/M2 Polarization through NF-κB Pathway.
Journal: Neuroscience | Authors: Rui Zhao | Species: human | Application: WB - MG132-mediated inhibition of the ubiquitin-proteasome pathway ameliorates cancer cachexia.
Journal: J Cancer Res Clin Oncol | Authors: Zhang Liuping L | Species: mouse | Application: WB - Thioredoxin-1 Protects Spinal Cord from Demyelination Induced by Methamphetamine through Suppressing Endoplasmic Reticulum Stress and Inflammation.
Journal: Front Neurol | Authors: Lihua Yang | Species: mouse | Application: WB - Cysteinyl Leukotriene Receptor 2 is Involved in Inflammation and Neuronal Damage by Mediating Microglia M1/M2 Polarization through NF-κB Pathway.
Journal: Neuroscience | Authors: Rui Zhao | Species: human | Application: WB - Thioredoxin-1 Protects Spinal Cord from Demyelination Induced by Methamphetamine through Suppressing Endoplasmic Reticulum Stress and Inflammation.
Journal: Front Neurol | Authors: Lihua Yang | Species: mouse | Application: WB - Triclocarban exposure aggravates dextran sulfate sodium-induced colitis by deteriorating the gut barrier function and microbial community in mice
Journal: Food Chem Toxicol | Authors: Mengyu Qin | Species: mouse | Application: WB,IF - Prednisone combined with dihydroartemisinin inhibits the excessive activation of skin keratinocytes in lupus erythematosus by targeting MAPK14.
Journal: Mol Cell Probes | Authors: Yan Chen - Placental ischemia-upregulated angiotensin II type 1 receptor in hypothalamic paraventricular nucleus contributes to hypertension in rat
Journal: Pflugers Arch | Authors: Abdoulaye Issotina Zibrila | Species: rat | Application: WB - P2X7 Receptor-Induced Bone Cancer Pain by Regulating Microglial Activity via NLRP3/IL-1beta Signaling
Journal: Pain Physician | Authors: Ping Wu | Species: rat | Application: IF - Knockdown of ST6Gal-I expression in human hepatocellular carcinoma cells inhibits their exosome-mediated proliferation- and migration-promoting effects.
Journal: IUBMB Life | Authors: Liping Wang | Species: human | Application: WB - Isoquercetin mitigates neuroinflammation and oxidative stress by targeting the NF-κB pathway.
Journal: Brain Res | Authors: Dilpreet Kaur | Species: zebrafish | Application: IHC - Bardoxolone methyl modulates Nrf2/NF-𝜅B signaling in turkey uterovaginal junction organoids with potential use for improving reproductive longevity in breeder hens.
Journal: Biol Reprod | Authors: Pitchaya Coleman | Application: IF - Response of the maternal hypothalamus to cold stress during late pregnancy in rats.
Journal: Brain Res | Authors: Di Wang | Species: rat | Application: WB - Escalating dose-multiple binge methamphetamine treatment elicits neurotoxicity, altering gut microbiota and fecal metabolites in mice.
Journal: Food Chem Toxicol | Authors: Li-Jian Chen | Species: mouse | Application: WB - Sulforaphane alleviates membranous nephropathy by inhibiting oxidative stress-associated podocyte pyroptosis
Journal: Iran J Basic Med Sci | Authors: Daoyuan Lv | Species: rat | Application: IHC - Attenuation of pro-tumorigenic senescent secretory phenotype by StN, a novel derivative of stevioside, potentiates its inhibitory activity on hepatocellular carcinoma
Journal: Food Chem Toxicol | Authors: Yanxia Guo | Species: human | Application: WB - Mechanism of hydroxychloroquine in the treatment of obstetric antiphospholipid syndrome by inhibiting NETs-induced trophoblast pyroptosis
Journal: Mol Biol Rep | Authors: Jiayue Liu | Species: human | Application: WB,IF - Investigating the role of itaconate in macrophage activation and oxidative stress injury in sepsis-associated acute kidney injury
Journal: Mol Biol Rep | Authors: Lei Yang | Species: mouse | Application: WB - Calmodulin Contributes to Lipolysis and Inflammatory Responses in Clinical Ketosis Cows through the TLR4/IKK/NF-κB Pathway
Journal: Animals (Basel) | Authors: Jinshui Chang | Species: bovine | Application: WB - Serum Exosomes miR-122-5P Induces Hepatic and Renal Injury in Septic Rats by Regulating TAK1/SIRT1 Pathway
Journal: Infect Drug Resist | Authors: Jiaqi Wang | Species: rat | Application: WB - Isoquercetin mitigates neuroinflammation and oxidative stress by targeting the NF-κB pathway.
Journal: Brain Res | Authors: Dilpreet Kaur | Species: zebrafish | Application: IHC - Vitamin C ameliorates D-galactose-induced senescence in HEI-OC1 cells by inhibiting the ROS/NF-κB pathway
Journal: Mol Biol Rep | Authors: Beibei Xu | Species: mouse | Application: WB - Response of the maternal hypothalamus to cold stress during late pregnancy in rats.
Journal: Brain Res | Authors: Di Wang | Species: rat | Application: WB - Kaempferol prevents the activation of complement C3 protein and the generation of reactive A1 astrocytes that mediate rat brain degeneration induced by 3-nitropropionic acid.
Journal: Food Chem Toxicol | Authors: Carmen Lopez-Sanchez | Species: rat | Application: WB - Garlic essential oil alleviate oxidative stress, inflammation and microbiota dybiosis from small intestinal damage in lipopolysaccharide-challenged weaned piglets.
Journal: Porcine Health Manag | Authors: Yun Chen | Species: pig | Application: WB - NLRC3 affects the development of psoriasis by modulating the NF-κB signaling pathway mediated inflammatory response through its interaction with TRAF6
Journal: Immunol Lett | Authors: Wanlu Zhang | Species: mouse,human | Application: WB - Alantolactone improves cognitive impairment in rats with Porphyromonas gingivalis infection by inhibiting neuroinflammation, oxidative stress, and reducing Aβ levels
Journal: Brain Res | Authors: ShuangFeng Chen | Species: rat | Application: WB - Ultrashort wave diathermy inhibits pulmonary inflammation in mice with acute lung injury in a HSP70 independent way: a pilot study
Journal: Mol Biol Rep | Authors: Xiao Yang | Species: mouse | Application: WB - Sulforaphane alleviates membranous nephropathy by inhibiting oxidative stress-associated podocyte pyroptosis
Journal: Iran J Basic Med Sci | Authors: Daoyuan Lv | Species: rat | Application: IHC - Ameliorative effect of MPAF on DSS-induced ulcerative colitis mice.
Journal: Mol Biol Rep | Authors: Chunlan Shan - Protective effects of the total saponins from Rosa laevigata Michx fruit against carbon tetrachloride-induced acute liver injury in mice.
Journal: Food Chem Toxicol | Authors: Dong Deshi D | Species: mouse | Application: WB - Fat Encapsulation Reduces Diarrhea in Piglets Partially by Repairing the Intestinal Barrier and Improving Fatty Acid Transport.
Journal: Animals (Basel) | Authors: Min Tian | Species: pig | Application: WB - Mechanism of hydroxychloroquine in the treatment of obstetric antiphospholipid syndrome by inhibiting NETs-induced trophoblast pyroptosis
Journal: Mol Biol Rep | Authors: Jiayue Liu | Species: human | Application: WB,IF - Bardoxolone methyl modulates Nrf2/NF-𝜅B signaling in turkey uterovaginal junction organoids with potential use for improving reproductive longevity in breeder hens.
Journal: Biol Reprod | Authors: Pitchaya Coleman | Application: IF - Placental ischemia-upregulated angiotensin II type 1 receptor in hypothalamic paraventricular nucleus contributes to hypertension in rat
Journal: Pflugers Arch | Authors: Abdoulaye Issotina Zibrila | Species: rat | Application: WB - Neuroinflammation induced by secretion of acetylated HMGB1 from activated microglia in hippocampi of mice following chronic cold exposure.
Journal: Brain Res | Authors: Bin Xu | Species: mouse | Application: WB - Investigating the role of itaconate in macrophage activation and oxidative stress injury in sepsis-associated acute kidney injury
Journal: Mol Biol Rep | Authors: Lei Yang | Species: mouse | Application: WB - Therapeutic potential of HUC-MSC-exos primed with IFN-γ against LPS-induced acute lung injury
Journal: Iran J Basic Med Sci | Authors: Chun Wang | Species: mouse,human | Application: WB - Mechanism of hydroxychloroquine in the treatment of obstetric antiphospholipid syndrome by inhibiting NETs-induced trophoblast pyroptosis
Journal: Mol Biol Rep | Authors: Jiayue Liu | Species: human | Application: WB,IF - Protection of the flavonoid fraction from Rosa laevigata Michx fruit against carbon tetrachloride-induced acute liver injury in mice.
Journal: Food Chem Toxicol | Authors: Zhang Shuai S | Species: mouse | Application: WB - Prednisone combined with dihydroartemisinin inhibits the excessive activation of skin keratinocytes in lupus erythematosus by targeting MAPK14.
Journal: Mol Cell Probes | Authors: Yan Chen - Vitamin C ameliorates D-galactose-induced senescence in HEI-OC1 cells by inhibiting the ROS/NF-κB pathway
Journal: Mol Biol Rep | Authors: Beibei Xu | Species: mouse | Application: WB - Compound essential oils relieve oxidative stress caused by PM2.5 exposure by inhibiting autophagy through the AMPK/mTOR pathway.
Journal: Environ Toxicol | Authors: Fei Ren | Species: mouse | Application: WB - Bergenin alleviates H2 O2 -induced oxidative stress and apoptosis in nucleus pulposus cells: Involvement of the PPAR-γ/NF-κB pathway.
Journal: Environ Toxicol | Authors: Gaofeng Zhang | Species: human | Application: WB - Amelioratory effect of neoandrographolide on myocardial ischemic-reperfusion injury by its anti-inflammatory and anti-apoptotic activities.
Journal: Environ Toxicol | Authors: Ying Liu | Species: rat,mouse | Application: WB,IF - Amelioratory effect of neoandrographolide on myocardial ischemic-reperfusion injury by its anti-inflammatory and anti-apoptotic activities.
Journal: Environ Toxicol | Authors: Ying Liu | Species: rat,mouse | Application: WB,IF - IFI16 regulates HTLV-1 replication through promoting HTLV-1 RTI-induced innate immune responses.
Journal: FEBS Lett | Authors: Bo Yang | Species: human | Application: WB - GFPT2 promotes metastasis and forms a positive feedback loop with p65 in colorectal cancer.
Journal: Am J Cancer Res | Authors: Lixin Liu | Species: human | Application: WB - Effect of Two Different Drug-Resistant Staphylococcus aureus Strains on the Physiological Properties of MAC-T Cells and Their Transcriptome Analysis.
Journal: Front Vet Sci | Authors: Lijiao Yan | Species: bovine | Application: WB - The outer membrane protein of Fusobacterium necrophorum, 43K OMP, stimulates inflammatory cytokine production through nuclear factor kappa B activation
Journal: Anaerobe | Authors: Xianjing He | Application: WB - Salidroside inhibits extracellular matrix deposition and oxidative stress in human trabecular meshwork cells by suppressing the TNF signaling pathway and upregulating MMP3 expression.
Journal: Tissue Cell | Authors: You Chen - Quercetin targeted NF-κB to regulate platelet activation and prevent arterial thrombosis.
Journal: Tissue Cell | Authors: Wenli Wang | Species: mouse | Application: WB - Herpes simplex virus 1 DNA polymerase processivity factor UL42 inhibits TNF-α-induced NF-κB activation by interacting with p65/RelA and p50/NF-κB1.
Journal: Med Microbiol Immunol | Authors: Zhang Jie J | Species: human | Application: WB,IP,IF - GFPT2 promotes metastasis and forms a positive feedback loop with p65 in colorectal cancer.
Journal: Am J Cancer Res | Authors: Lixin Liu | Species: human | Application: WB - MicroRNA-27a/b mediates endothelin-1-induced PPARγ reduction and proliferation of pulmonary artery smooth muscle cells.
Journal: Cell Tissue Res | Authors: Xinming Xie | Species: rat | Application: WB - Bta-miR-223 Targeting CBLB Contributes to Resistance to Staphylococcus aureus Mastitis Through the PI3K/AKT/NF-κB Pathway.
Journal: Front Vet Sci | Authors: Shuo Han | Species: mouse,human | Application: WB - Chymotrypsin attenuates adjuvant-induced arthritis by downregulating TLR4, NF-κB, MMP-1, TNF-α, IL-1β and IL-6 expression in Sprague- Dawley rats.
Journal: Immunopharmacol Immunotoxicol | Authors: Jianqiang Li | Species: rat | Application: WB - Tumor-derived Immunoglobulin-like transcript 4 facilitates angiogenesis of colorectal cancer
Journal: Am J Cancer Res | Authors: Jing Liu | Species: mouse | Application: IHC - PM2.5 induced lung injury through upregulating ROS-dependent NLRP3 Inflammasome-Mediated Pyroptosis.
Journal: Immunobiology | Authors: Fei Ren | Application: WB - Placental extracellular vesicles induce ovarian tumour cell death in an ex vivo explant model: Possible therapeutic potential
Journal: Placenta | Authors: Xinyi Sun | Species: human | Application: WB - Overexpression of the Mas1 gene mitigated LPS-induced inflammatory injury in mammary epithelial cells by inhibiting the NF-κB/MAPKs signaling pathways
Journal: Front Vet Sci | Authors: Shuping Yan | Species: mouse | Application: WB - The Spinal α7-Nicotinic Acetylcholine Receptor Contributes to the Maintenance of Cancer-Induced Bone Pain.
Journal: J Pain Res | Authors: Ting Yang | Species: rat | Application: WB - Neuropilin-2 (NRP2) mediates sorafenib resistance in clear cell renal cell carcinoma via the NRP2/NF-κB/TNFα axis.
Journal: Am J Cancer Res | Authors: Ruichen Gu | Species: human | Application: WB - Downregulation of the immunoproteasome subunit PSMB8 attenuates sepsis-associated acute kidney injury through the NF-κB pathway
Journal: Immunobiology | Authors: Min Li | Species: human | Application: WB - Bta-miR-223 Targeting CBLB Contributes to Resistance to Staphylococcus aureus Mastitis Through the PI3K/AKT/NF-κB Pathway.
Journal: Front Vet Sci | Authors: Shuo Han | Species: mouse,human | Application: WB - Mechanisms of topical Mahoniae Caulis against acute mastitis: Integrating SMR, network pharmacology, molecular docking, and experimental validation.
Journal: Tissue Cell | Authors: Shihan Feng | Species: mouse | Application: WB - Soy isoflavones inhibits MMPs expression in keratoconus keratocytes through NF-κB pathway.
Journal: Exp Eye Res | Authors: Jindong Zhang | Species: human | Application: WB - GIT2 negatively regulates the NF-κB pathway directly or indirectly by regulating TRAF3 expression to promote osteogenic differentiation of BMSCs
Journal: Tissue Cell | Authors: Yanna Wang | Species: mouse | Application: WB - Iodoacetamide triggers ovarian dysfunction in mice through TGF-β signaling pathway and apoptosis
Journal: Toxicol Lett | Authors: Chenyu Xiao | Species: mouse | Application: WB - Structural and immunohistochemical characterization of skeletal muscle in molly fish (Poecilia sphenops).
Journal: Tissue Cell | Authors: Sabreen M. Ghareeb - Adiponectin attenuates atherosclerosis via macrophage polarization-mediated T Cell exhaustion by modulating the NF-κB p65/PI3K/Akt signaling pathway
Journal: Tissue Cell | Authors: Man Qin - Placental extracellular vesicles induce ovarian tumour cell death in an ex vivo explant model: Possible therapeutic potential
Journal: Placenta | Authors: Xinyi Sun | Species: human | Application: WB - Overexpression of the Mas1 gene mitigated LPS-induced inflammatory injury in mammary epithelial cells by inhibiting the NF-κB/MAPKs signaling pathways
Journal: Front Vet Sci | Authors: Shuping Yan | Species: mouse | Application: WB - Herpes simplex virus 1 DNA polymerase processivity factor UL42 inhibits TNF-α-induced NF-κB activation by interacting with p65/RelA and p50/NF-κB1.
Journal: Med Microbiol Immunol | Authors: Zhang Jie J | Species: human | Application: WB,IP,IF - Mulberroside a protects against ischemic impairment in primary culture of rat cortical neurons after oxygen-glucose deprivation followed by reperfusion.
Journal: J Neurosci Res | Authors: Cai-Ping Wang | Application: WB - Rhizoma Dioscoreae Nipponicae polysaccharides protect HUVECs from H2O2-induced injury by regulating PPARγ factor and the NADPH oxidase/ROS-NF-κB signal pathway.
Journal: Toxicol Lett | Authors: Yue Jin | Species: human | Application: WB - PM2.5 induced lung injury through upregulating ROS-dependent NLRP3 Inflammasome-Mediated Pyroptosis.
Journal: Immunobiology | Authors: Fei Ren | Application: WB - Herpes simplex virus 1 DNA polymerase processivity factor UL42 inhibits TNF-α-induced NF-κB activation by interacting with p65/RelA and p50/NF-κB1.
Journal: Med Microbiol Immunol | Authors: Zhang Jie J | Species: human | Application: WB,IP,IF - Quercetin targeted NF-κB to regulate platelet activation and prevent arterial thrombosis.
Journal: Tissue Cell | Authors: Wenli Wang | Species: mouse | Application: WB - Potential mechanisms of zinc sulfate in inhibiting porcine reproductive and respiratory syndrome virus replication: attenuation of oxidative stress, inflammatory response, and apoptosis.
Journal: Front Vet Sci | Authors: Huizhen Yang | Species: monkey | Application: WB - Metadherin silencing results in the inhibition of pyroptosis in lipopolysaccharide/adenosine triphosphate - stimulated renal tubular epithelial cells.
Journal: Tissue Cell | Authors: Xiuping Duan | Application: IF - The outer membrane protein of Fusobacterium necrophorum, 43K OMP, stimulates inflammatory cytokine production through nuclear factor kappa B activation
Journal: Anaerobe | Authors: Xianjing He | Application: WB - HB-EGF-induced IL-8 secretion from airway epithelium leads to lung fibroblast proliferation and migration.
Journal: BMC Pulm Med | Authors: Yanyu Li | Species: human | Application: WB - Paquinimod attenuates retinal injuries by suppressing the S100A9/TLR4 signaling in an experimental model of diabetic retinopathy
Journal: Exp Eye Res | Authors: Can Deng | Species: human | Application: WB - Tropisetron attenuates lipopolysaccharide induced neuroinflammation by inhibiting NF-κB and SP/NK1R signaling pathway.
Journal: J Neuroimmunol | Authors: Yan Yu | Species: mouse | Application: WB - Rhizoma Dioscoreae Nipponicae polysaccharides protect HUVECs from H2O2-induced injury by regulating PPARγ factor and the NADPH oxidase/ROS-NF-κB signal pathway.
Journal: Toxicol Lett | Authors: Yue Jin | Species: human | Application: WB - Neuropilin-2 (NRP2) mediates sorafenib resistance in clear cell renal cell carcinoma via the NRP2/NF-κB/TNFα axis.
Journal: Am J Cancer Res | Authors: Ruichen Gu | Species: human | Application: WB - HB-EGF-induced IL-8 secretion from airway epithelium leads to lung fibroblast proliferation and migration.
Journal: BMC Pulm Med | Authors: Yanyu Li | Species: human | Application: WB - Overexpression of the Mas1 gene mitigated LPS-induced inflammatory injury in mammary epithelial cells by inhibiting the NF-κB/MAPKs signaling pathways
Journal: Front Vet Sci | Authors: Shuping Yan | Species: mouse | Application: WB - Potential mechanisms of zinc sulfate in inhibiting porcine reproductive and respiratory syndrome virus replication: attenuation of oxidative stress, inflammatory response, and apoptosis.
Journal: Front Vet Sci | Authors: Huizhen Yang | Species: monkey | Application: WB - The dual action of astaxanthin: activating the Nrf2 pathway and suppressing NF-κB to combat AFB1-induced liver injury in broilers.
Journal: BMC Vet Res | Authors: Kai Kang | Species: chicken | Application: WB - Metadherin silencing results in the inhibition of pyroptosis in lipopolysaccharide/adenosine triphosphate - stimulated renal tubular epithelial cells.
Journal: Tissue Cell | Authors: Xiuping Duan | Application: IF - Salidroside inhibits extracellular matrix deposition and oxidative stress in human trabecular meshwork cells by suppressing the TNF signaling pathway and upregulating MMP3 expression.
Journal: Tissue Cell | Authors: You Chen - Downregulation of the immunoproteasome subunit PSMB8 attenuates sepsis-associated acute kidney injury through the NF-κB pathway
Journal: Immunobiology | Authors: Min Li | Species: human | Application: WB - MiR-22 restrains proliferation of rheumatoid arthritis by targeting IL6R and may be concerned with the suppression of NF-κB pathway.
Journal: Kaohsiung J Med Sci | Authors: Qing-Yi Yang | Species: human | Application: WB - The TLR4/NF-κB/NLRP3 pathway is involved in levofloxacin-induced alleviation of neuroinflammation in Parkinson's disease.
Journal: J Neuroimmunol | Authors: Xingyue Chen - Andrographolide Inhibits Proliferation and Promotes Apoptosis in Bladder Cancer Cells by Interfering with NF-κB and PI3K/AKT Signaling In Vitro and In Vivo.
Journal: Chin J Integr Med | Authors: Lei Xuan | Species: human | Application: WB - Metadherin silencing results in the inhibition of pyroptosis in lipopolysaccharide/adenosine triphosphate - stimulated renal tubular epithelial cells.
Journal: Tissue Cell | Authors: Xiuping Duan | Application: IF - Endosulfan induces endothelial inflammation and dysfunction via IRE1α/NF-κB signaling pathway.
Journal: Environ Sci Pollut Res Int | Authors: ShiTian Sun | Species: human | Application: WB - Endosulfan induces endothelial inflammation and dysfunction via IRE1α/NF-κB signaling pathway.
Journal: Environ Sci Pollut Res Int | Authors: ShiTian Sun | Species: human | Application: WB - microRNA-338-3p suppresses lipopolysaccharide-induced inflammatory response in HK-2 cells
Journal: BMC Mol Cell Biol | Authors: Jing Wang | Species: human | Application: WB - Gastrodin Alleviates Lumbar Intervertebral Disc Degeneration by Suppressing the NF-κB and MAPK Pathways
Journal: Cell Biochem Biophys | Authors: Huimin Hu | Species: rat | Application: IF - Steroidogenic acute regulatory protein (StAR) overexpression reduces inflammation and insulin resistance in obese mice.
Journal: J Cell Biochem | Authors: Yanyan Qiu | Species: mouse | Application: WB - Influence of feature rankers in the construction of molecular activity prediction models.
Journal: J Comput Aided Mol Des | Authors: Gonzalo Cerruela-García | Species: rat | Application: WB - Combined treatment with dihydrotestosterone and lipopolysaccharide modulates prostate homeostasis by upregulating TNF-α from M1 macrophages and promotes proliferation of prostate stromal cells.
Journal: Asian J Androl | Authors: Yu Tong | Species: human | Application: WB - microRNA-338-3p suppresses lipopolysaccharide-induced inflammatory response in HK-2 cells
Journal: BMC Mol Cell Biol | Authors: Jing Wang | Species: human | Application: WB - Influence of feature rankers in the construction of molecular activity prediction models.
Journal: J Comput Aided Mol Des | Authors: Gonzalo Cerruela-García | Species: rat | Application: WB - Maternal Overnutrition During Gestation in Sheep Alters Autophagy Associated Pathways in Offspring Heart.
Journal: Front Genet | Authors: Yang Liu | Application: WB - Administration of krill oil extends lifespan of fish Nothobranchius guentheri via enhancement of antioxidant system and suppression of NF-κB pathway.
Journal: Fish Physiol Biochem | Authors: Lili Song | Application: WB - Dehydrocostus Lactone Ameliorates LPS-Induced Acute Lung Injury by Inhibiting PFKFB3-Mediated Glycolysis
Journal: J Cell Biochem | Authors: Yue Li | Species: mouse | Application: WB,IF - Rabdosichuanin C inhibits productions of pro-inflammatory mediators regulated by NF-κB signaling in LPS-stimulated RAW264.7 cells
Journal: J Cell Biochem | Authors: Zhang Lingxia | Species: mouse | Application: WB - Administration of krill oil extends lifespan of fish Nothobranchius guentheri via enhancement of antioxidant system and suppression of NF-κB pathway.
Journal: Fish Physiol Biochem | Authors: Lili Song | Application: WB - ACT001 can prevent and reverse tamoxifen resistance in human breast cancer cell lines by inhibiting NF-κB activation.
Journal: J Cell Biochem | Authors: Xiao-Han Jin | Species: human | Application: IF - Effects of growth hormone/estrogen/androgen on COVID-19-type proinflammatory responses in normal human lung epithelial BEAS-2B cells
Journal: BMC Mol Cell Biol | Authors: Zemin Zhu | Species: human | Application: WB - Dehydrocostus Lactone Ameliorates LPS-Induced Acute Lung Injury by Inhibiting PFKFB3-Mediated Glycolysis
Journal: J Cell Biochem | Authors: Yue Li | Species: mouse | Application: WB,IF - Anti-neuroinflammatory effects of dimethylaminomylide (DMAMCL, i.e., ACT001) are associated with attenuating the NLRP3 inflammasome in MPTP-induced Parkinson disease in mice.
Journal: Behav Brain Res | Authors: Qianqian Liu | Species: mouse | Application: WB - Extraction technology, component analysis, and the immunomodulatory effects in immunosuppressed broilers of total flavonoids extract from the thorns of Gleditsia sinensis Lam
Journal: Fitoterapia | Authors: Jingyi Xu | Application: WB - Overexpression of the nucleoporin Nup88 stimulates migration and invasion of HeLa cells.
Journal: Histochem Cell Biol | Authors: Masaki Makise | Species: human | Application: WB - Extraction technology, component analysis, and the immunomodulatory effects in immunosuppressed broilers of total flavonoids extract from the thorns of Gleditsia sinensis Lam
Journal: Fitoterapia | Authors: Jingyi Xu | Application: WB - Anti-neuroinflammatory effects of dimethylaminomylide (DMAMCL, i.e., ACT001) are associated with attenuating the NLRP3 inflammasome in MPTP-induced Parkinson disease in mice.
Journal: Behav Brain Res | Authors: Qianqian Liu | Species: mouse | Application: WB - Prenatal cold stress: Effect on maternal hippocampus and offspring behavior in rats.
Journal: Behav Brain Res | Authors: Shuai Lian | Species: rat | Application: WB - In vitro and in vivo biological evaluation of Lappaconitine derivatives as potential anti-inflammatory agents
Journal: Chem Biodivers | Authors: Yan Xiao | Species: mouse | Application: WB - The role of STIM1 in the Cr(vi)-induced [Ca(2+)]i increase and cell injury in L-02 hepatocytes.
Journal: Metallomics | Authors: Xing Yi | Species: human | Application: WB - Assessing the effects of tempol on renal fibrosis, inflammation, and oxidative stress in a high-salt diet combined with 5/6 nephrectomy rat model: utilizing oxidized albumin as a biomarker
Journal: BMC Nephrol | Authors: Beibei Liu | Species: rat | Application: WB - Sulfonation of Capsaicin by sulfotransferases produces an anti-inflammatory metabolite with NF-κB pathway modulatory activity
Journal: Fitoterapia | Authors: Wanyu Hu | Species: mouse | Application: WB - Osthole Activates the Cholinergic Anti-Inflammatory Pathway via α7nAChR Upregulation to Alleviate Inflammatory Responses
Journal: Chem Biodivers | Authors: Shu-Hang Li | Species: mouse | Application: WB - Overexpression of the nucleoporin Nup88 stimulates migration and invasion of HeLa cells.
Journal: Histochem Cell Biol | Authors: Masaki Makise | Species: human | Application: WB - Preventive effects of the AMPA receptor potentiator LY450108 in an LPS-induced depressive mouse model.
Journal: Behav Brain Res | Authors: Hui Yao | Species: human | Application: WB - The Class III PI3K/Beclin-1 Autophagic Pathway Participates in the mmLDL-Induced Upregulation of ETA Receptor in Mouse Mesenteric Arteries.
Journal: Adv Pharmacol Pharm Sci | Authors: Xi Xie | Species: mouse | Application: WB - Preventive effects of the AMPA receptor potentiator LY450108 in an LPS-induced depressive mouse model.
Journal: Behav Brain Res | Authors: Hui Yao | Species: human | Application: WB - Panax notoginseng Saponins Regulate Macrophage Polarization under Hyperglycemic Condition via NF-κB Signaling Pathway.
Journal: Biomed Res Int | Authors: Yan Zhao | Species: human | Application: WB - In vitro and in vivo biological evaluation of Lappaconitine derivatives as potential anti-inflammatory agents
Journal: Chem Biodivers | Authors: Yan Xiao | Species: mouse | Application: WB - Research on the Pharmacodynamic Substances and Mechanism of Action of Tibetan Medicine Liuwei Muxiang Powder in the Treatment of Ethanol-Induced Gastric Ulcer Model of GES1 Cell
Journal: Chem Biodivers | Authors: Haisha Lu - HMGB1/RAGE signaling mediates the activation of microglia and participates in depressive-like behaviors and cognitive deficits in rats after ischemia-reperfusion
Journal: Behav Brain Res | Authors: Lifei Fan | Species: rat | Application: WB - Overexpression of the nucleoporin Nup88 stimulates migration and invasion of HeLa cells.
Journal: Histochem Cell Biol | Authors: Masaki Makise | Species: human | Application: WB - Assessing the effects of tempol on renal fibrosis, inflammation, and oxidative stress in a high-salt diet combined with 5/6 nephrectomy rat model: utilizing oxidized albumin as a biomarker
Journal: BMC Nephrol | Authors: Beibei Liu | Species: rat | Application: WB - Tas2R143 regulates the expression of the Blood-Testis Barrier tight junction protein in TM4 cells through the NF-κB signaling pathway
Journal: Theriogenology | Authors: Xue Wang | Species: mouse | Application: WB,IF - Sulfonation of Capsaicin by sulfotransferases produces an anti-inflammatory metabolite with NF-κB pathway modulatory activity
Journal: Fitoterapia | Authors: Wanyu Hu | Species: mouse | Application: WB - Melatonin alleviates oxidative stress and inflammation of Leydig cells of Min pig through SIRT1 pathway
Journal: Theriogenology | Authors: Yanru Chen | Species: pig | Application: WB - Extraction technology, component analysis, and the immunomodulatory effects in immunosuppressed broilers of total flavonoids extract from the thorns of Gleditsia sinensis Lam
Journal: Fitoterapia | Authors: Jingyi Xu | Application: WB - Anti-Inflammatory and Antioxidant Effect of Eucommia ulmoides Polysaccharide in Hepatic Ischemia-Reperfusion Injury by Regulating ROS and the TLR-4-NF-κB Pathway.
Journal: Biomed Res Int | Authors: Weidong Gao | Species: rat | Application: WB - HMGB1/RAGE signaling mediates the activation of microglia and participates in depressive-like behaviors and cognitive deficits in rats after ischemia-reperfusion
Journal: Behav Brain Res | Authors: Lifei Fan | Species: rat | Application: WB - Gentiana szechenyii Kanitz Compounds Regulate Lipopolysaccharide-Induced Inflammation and Mitochondrial Autophagy Via the Toll-Like Receptor 4-Nuclear Factor Kappa B Pathway.
Journal: Chem Biodivers | Authors: Haihua Zhang | Species: mouse | Application: WB - Assessing the effects of tempol on renal fibrosis, inflammation, and oxidative stress in a high-salt diet combined with 5/6 nephrectomy rat model: utilizing oxidized albumin as a biomarker
Journal: BMC Nephrol | Authors: Beibei Liu | Species: rat | Application: WB - Rapamycin suppresses inflammation and increases the interaction between p65 and IκBα in rapamycin-induced fatty livers
Journal: PLoS One | Authors: Chenliang Ge | Species: mouse | Application: IF - Structural and immunohistochemical analysis of the cellular compositions of the liver of molly fish (Poecilia sphenops), focusing on its immune role
Journal: Zoological Lett | Authors: Marwa M Hussein | Application: IHC - L-F001, a multifunctional fasudil-lipoic acid dimer, antagonizes hypoxic-ischemic brain damage by inhibiting the TLR4/MyD88 signaling pathway
Journal: Brain Behav | Authors: Ruiyu Zhou | Species: rat | Application: WB - L-F001, a multifunctional fasudil-lipoic acid dimer, antagonizes hypoxic-ischemic brain damage by inhibiting the TLR4/MyD88 signaling pathway
Journal: Brain Behav | Authors: Ruiyu Zhou | Species: rat | Application: WB - A preliminary study of T-2 toxin that cause liver injury in rats via the NF-kB and NLRP3-mediated pyroptosis pathway
Journal: Toxicon | Authors: Shicong Zheng | Species: rat | Application: WB - Small molecule screening identified cepharanthine as an inhibitor of porcine reproductive and respiratory syndrome virus infection in vitro by suppressing integrins/ILK/RACK1/PKCα/NF-κB signalling axis.
Journal: Vet Microbiol | Authors: Chao Yang | Species: pig,monkey | Application: WB - 14-3-3ε mediates the cell fate decision-making pathways in response of hepatocellular carcinoma to Bleomycin-induced DNA damage.
Journal: PLoS One | Authors: Tang Siwei S | Species: human | Application: WB - Protease Amplification of the Inflammatory Response Induced by Commensal Bacteria: Implications for Racial Disparity in Term and Preterm Birth.
Journal: Reprod Sci | Authors: Scott W Walsh | Species: human | Application: IF - Rapamycin suppresses inflammation and increases the interaction between p65 and IκBα in rapamycin-induced fatty livers
Journal: PLoS One | Authors: Chenliang Ge | Species: mouse | Application: IF - L-F001, a multifunctional fasudil-lipoic acid dimer, antagonizes hypoxic-ischemic brain damage by inhibiting the TLR4/MyD88 signaling pathway
Journal: Brain Behav | Authors: Ruiyu Zhou | Species: rat | Application: WB - ETA-mediated anti-TNF-α therapy ameliorates the phenotype of PCOS model induced by letrozole.
Journal: PLoS One | Authors: Qin Lang | Species: mouse | Application: WB,IF - Antitumor activity of a novel dual functional podophyllotoxin derivative involved PI3K/AKT/mTOR pathway.
Journal: PLoS One | Authors: Yongli Li | Species: human | Application: WB - Pasteurella multocida causes liver pyroptosis in broilers through the MAPK-NLRP3-GSDMD signaling pathway.
Journal: Vet Microbiol | Authors: Deqiang Yan - The role of TLR2/MyD88/NF-κB pathway-mediated macrophage M1 polarization in recurrent spontaneous abortion associated with antiphospholipid syndrome.
Journal: Hum Cell | Authors: Xiaolan Huang | Species: human | Application: WB - Electroacupuncture Improving Intestinal Barrier Function in Rats with Irritable Bowel Syndrome Through Regulating Aquaporins
Journal: Dig Dis Sci | Authors: Xueling Kang | Species: rat | Application: IHC - Proteases Activate Pregnancy Neutrophils by a Protease-Activated Receptor 1 Pathway: Epigenetic Implications for Preeclampsia.
Journal: Reprod Sci | Authors: Scott W Walsh | Species: human | Application: IF - The Nox1/Nox4 inhibitor attenuates acute lung injury induced by ischemia-reperfusion in mice.
Journal: PLoS One | Authors: Yu Cui | Species: mouse | Application: WB - Potential diagnostic markers and therapeutic targets for DM2 and periodontitis based on bioinformatics analysis
Journal: PLoS One | Authors: Rong Luo | Application: WB - HIF-1α inhibits the TLR4/NF-κB signaling pathway and modulates intestinal flora in diarrhea-predominant irritable bowel syndrome.
Journal: PLoS One | Authors: Xing He - L-F001, a multifunctional fasudil-lipoic acid dimer, antagonizes hypoxic-ischemic brain damage by inhibiting the TLR4/MyD88 signaling pathway
Journal: Brain Behav | Authors: Ruiyu Zhou | Species: rat | Application: WB - Sevoflurane Protects against Intestinal Ischemia-Reperfusion Injury by Activating Peroxisome Proliferator-Activated Receptor Gamma/Nuclear Factor-κB Pathway in Rats.
Journal: Pharmacology | Authors: Chuiliang Liu | Species: rat | Application: WB - L-F001, a multifunctional fasudil-lipoic acid dimer, antagonizes hypoxic-ischemic brain damage by inhibiting the TLR4/MyD88 signaling pathway
Journal: Brain Behav | Authors: Ruiyu Zhou | Species: rat | Application: WB - Curcumin alleviates osteoarthritis in mice by suppressing osteoclastogenesis in subchondral bone via inhibiting NF-κB/JNK signaling pathway
Journal: PLoS One | Authors: Dong Ding | Species: mouse | Application: WB,IHC - Gold Nanoparticle Delivery of Glut1 siRNA Facilitates Glucose Starvation Therapy in Lung Cancer
Journal: Chembiochem | Authors: Jiaqi Li | Species: human | Application: WB - miR-34a and its novel target, NLRC5, are associated with HPV16 persistence.
Journal: Infect Genet Evol | Authors: Jinyuan Li - RSAD2 inhibits Senecavirus A replication by promoting type I interferons induction downstream of cGAS-STING and NF-κB signaling pathway.
Journal: Vet Microbiol | Authors: Huizi Li | Species: pig | Application: WB - Activation of the TLR2/NF-κB signaling axis by capsid proteinVP1 of feline calicivirus promotes IL-1β expression in vitro
Journal: Vet Microbiol | Authors: Jiuyuan Liu | Application: WB - Porcine RACK1 negatively regulates the infection of classical swine fever virus and the NF-κB activation in PK-15 cells.
Journal: Vet Microbiol | Authors: Xiaochun Wang | Species: pig | Application: WB - The Nox1/Nox4 inhibitor attenuates acute lung injury induced by ischemia-reperfusion in mice.
Journal: PLoS One | Authors: Yu Cui | Species: mouse | Application: WB - miR-34a and its novel target, NLRC5, are associated with HPV16 persistence.
Journal: Infect Genet Evol | Authors: Jinyuan Li - Ethyl pyruvate pretreatment attenuates concanavalin a-induced autoimmune hepatitis in mice.
Journal: PLoS One | Authors: Miao Shen | Species: mouse | Application: WB,IHC - Structural and immunohistochemical analysis of the cellular compositions of the liver of molly fish (Poecilia sphenops), focusing on its immune role
Journal: Zoological Lett | Authors: Marwa M Hussein | Application: IHC - IL-17 signaling pathway in monocytes drives the persistent inflammatory cytokine storm caused by Glaesserella parasuis infection in pigs.
Journal: Vet Microbiol | Authors: Peiyi Wang | Species: pig | Application: WB - Gold Nanoparticle Delivery of Glut1 siRNA Facilitates Glucose Starvation Therapy in Lung Cancer
Journal: Chembiochem | Authors: Jiaqi Li | Species: human | Application: WB - Potential diagnostic markers and therapeutic targets for DM2 and periodontitis based on bioinformatics analysis
Journal: PLoS One | Authors: Rong Luo | Application: WB - Sevoflurane Protects against Intestinal Ischemia-Reperfusion Injury by Activating Peroxisome Proliferator-Activated Receptor Gamma/Nuclear Factor-κB Pathway in Rats.
Journal: Pharmacology | Authors: Chuiliang Liu | Species: rat | Application: WB - Pasteurella multocida causes liver pyroptosis in broilers through the MAPK-NLRP3-GSDMD signaling pathway.
Journal: Vet Microbiol | Authors: Deqiang Yan - The Nox1/Nox4 inhibitor attenuates acute lung injury induced by ischemia-reperfusion in mice.
Journal: PLoS One | Authors: Yu Cui | Species: mouse | Application: WB - RSAD2 inhibits Senecavirus A replication by promoting type I interferons induction downstream of cGAS-STING and NF-κB signaling pathway.
Journal: Vet Microbiol | Authors: Huizi Li | Species: pig | Application: WB - IL-17 signaling pathway in monocytes drives the persistent inflammatory cytokine storm caused by Glaesserella parasuis infection in pigs.
Journal: Vet Microbiol | Authors: Peiyi Wang | Species: pig | Application: WB - Shikonin Exerts an Antileukemia Effect against FLT3-ITD Mutated Acute Myeloid Leukemia Cells via Targeting FLT3 and Its Downstream Pathways
Journal: Acta Haematol | Authors: Mu-Nan Zhao | Species: human | Application: IF - The role of TLR2/MyD88/NF-κB pathway-mediated macrophage M1 polarization in recurrent spontaneous abortion associated with antiphospholipid syndrome.
Journal: Hum Cell | Authors: Xiaolan Huang | Species: human | Application: WB - Protective effect of dioscin against thioacetamide-induced acute liver injury via FXR/AMPK signaling pathway in vivo.
Journal: Biomed Pharmacother | Authors: Lingli Zheng | Species: rat | Application: WB - Evodiamine as the Active Compound of Evodiae fructus to Inhibit Proliferation and Migration of Prostate Cancer through PI3K/AKT/NF-κB Signaling Pathway.
Journal: Dis Markers | Authors: Yuhe Lei | Species: human | Application: WB - ETC-1002 Attenuates Porphyromonas gingivalis Lipopolysaccharide-Induced Inflammation in RAW264.7 Cells via the AMPK/NF-κB Pathway and Exerts Ameliorative Effects in Experimental Periodontitis in Mice.
Journal: Dis Markers | Authors: Hongyan Li | Application: WB - Effects of Electroacupuncture on Gastrointestinal Motility Function, Pain, and Inflammation via Transient Receptor Potential Vanilloid 1 in a Rat Model after Colonic Anastomoses.
Journal: Dis Markers | Authors: Xuelai Zhong | Species: rat | Application: WB,IF - SOGA1 drives ovarian cancer progression via regulation of GNAI1 and activation of the TNF/NF-κB pathway
Journal: Gene | Authors: Tengfei Long | Application: WB - miR-146a/b-5p-IRAK1-NF-κB Axis Regulates Unexplained Recurrent Spontaneous Abortion.
Journal: J Mol Recognit | Authors: Fengping He | Species: mouse,human | Application: WB - Up-regulation of ABCG2 by MYBL2 deletion drives Chlorin e6-mediated photodynamic therapy resistance in colorectal cancer
Journal: Photodiagnosis Photodyn Ther | Authors: Yuan-Jian Hui | Species: human | Application: WB - Aerobic exercise modulates RIPK1-mediated MAP3K5/JNK and NF-κB pathways to suppress microglia activation and neuroinflammation in the hippocampus of D-gal-induced accelerated aging mice
Journal: Physiol Behav | Authors: Yang Liu | Species: mouse | Application: WB - MiR-34a-5p up-regulates the IL-1β/COX2/PGE2 inflammation pathway and induces the release of CGRP via inhibition of SIRT1 in rat trigeminal ganglion neurons.
Journal: FEBS Open Bio | Authors: Hui Zhang | Species: rat | Application: WB - Dual neutralization of TGF-β and IL-21 regulates Th17/Treg balance by suppressing inflammatory signalling in the splenic lymphocytes of Staphylococcus aureus infection-induced septic arthritic mice
Journal: Immunol Res | Authors: Rochana Pramanik | Species: mouse | Application: WB - Pulsatilla Saponin B4 Ameliorates LPS-Induced Inflammatory Response by Inhibiting IL-17RA and MAPK/NF-κB Signaling in Bovine Mammary Epithelial Cells and Mastitis Mouse Model.
Journal: Vet Sci | Authors: Hao Zhang | Species: mouse | Application: WB - Knockout of the C4BPA Gene Promotes Mitophagy via Activation of the Pink1/Parkin Pathway and Alleviates the Inflammatory Response by Inhibiting the NF-κB Signalling Pathway in Bovine Mammary Epithelial Cells.
Journal: Vet Sci | Authors: Yanlong Zhou | Species: bovine | Application: WB - The Effect of Meloxicam on Inflammatory Response and Oxidative Stress Induced by Klebsiella pneumoniae in Bovine Mammary Epithelial Cells
Journal: Vet Sci | Authors: Kangjun Liu | Species: bovine | Application: WB,IF - Cetuximab enhances oridonin-induced apoptosis through mitochondrial pathway and endoplasmic reticulum stress in laryngeal squamous cell carcinoma cells.
Journal: Toxicol In Vitro | Authors: Ning Kang | Species: human | Application: WB,IF - Prognostic Significance of Nuclear Factor Kappa B (p65) among Breast Cancer Patients in Cape Coast Teaching Hospital
Journal: Med Princ Pract | Authors: Precious Barnes | Species: human | Application: IHC - The role of growth differentiation factor 15 in the polarization and foaming of THP-1 macrophages induced by trans fatty acids from different sources.
Journal: Toxicol In Vitro | Authors: Jingyuan Lin - Knockout of the C4BPA Gene Promotes Mitophagy via Activation of the Pink1/Parkin Pathway and Alleviates the Inflammatory Response by Inhibiting the NF-κB Signalling Pathway in Bovine Mammary Epithelial Cells.
Journal: Vet Sci | Authors: Yanlong Zhou | Species: bovine | Application: WB - RING-Finger Protein 6 promotes Drug Resistance in Retinoblastoma via JAK2/STAT3 Signaling Pathway.
Journal: Pathol Oncol Res | Authors: Yong Chai | Species: human | Application: WB - Multi-Omics Unveils Inflammatory Regulation of Fermented Sini Decoction Dregs in Broilers Infected with Avian Pathogenic Escherichia coli
Journal: Vet Sci | Authors: Shuanghao Mo | Species: chicken | Application: WB - Nicotine-Induced Neuroprotection against Cognitive Dysfunction after Partial Hepatectomy Involves Activation of BDNF/TrkB Signaling Pathway and Inhibition of NF-κB Signaling Pathway in Aged Rats.
Journal: Nicotine Tob Res | Authors: Penghui Wei | Species: rat | Application: WB - Epithelial-specific deletion of FAM20A leads to Short Root Defects
Journal: Gene | Authors: Lixue Liu | Species: mouse | Application: WB - The Effect of Meloxicam on Inflammatory Response and Oxidative Stress Induced by Klebsiella pneumoniae in Bovine Mammary Epithelial Cells
Journal: Vet Sci | Authors: Kangjun Liu | Species: bovine | Application: WB,IF - Pulsatilla Saponin B4 Ameliorates LPS-Induced Inflammatory Response by Inhibiting IL-17RA and MAPK/NF-κB Signaling in Bovine Mammary Epithelial Cells and Mastitis Mouse Model.
Journal: Vet Sci | Authors: Hao Zhang | Species: mouse | Application: WB - The role of growth differentiation factor 15 in the polarization and foaming of THP-1 macrophages induced by trans fatty acids from different sources.
Journal: Toxicol In Vitro | Authors: Jingyuan Lin - Dual neutralization of TGF-β and IL-21 regulates Th17/Treg balance by suppressing inflammatory signalling in the splenic lymphocytes of Staphylococcus aureus infection-induced septic arthritic mice
Journal: Immunol Res | Authors: Rochana Pramanik | Species: mouse | Application: WB - Nicotine-Induced Neuroprotection against Cognitive Dysfunction after Partial Hepatectomy Involves Activation of BDNF/TrkB Signaling Pathway and Inhibition of NF-κB Signaling Pathway in Aged Rats.
Journal: Nicotine Tob Res | Authors: Penghui Wei | Species: rat | Application: WB - Up-regulation of ABCG2 by MYBL2 deletion drives Chlorin e6-mediated photodynamic therapy resistance in colorectal cancer
Journal: Photodiagnosis Photodyn Ther | Authors: Yuan-Jian Hui | Species: human | Application: WB - Electroacupuncture restores intestinal mucosal barrier through TLR4/NF-κB p65 pathway in functional dyspepsia-like rats.
Journal: Anat Rec (Hoboken) | Authors: Dan Wang | Species: rat | Application: WB - Pseudorabies virus UL13 primes inflammatory response through downregulating heat shock factor 1
Journal: Virology | Authors: Wen-Jing Zhang | Species: human | Application: WB - Zuyangping formula promotes skin wound healing in diabetic rats
Journal: J Tradit Chin Med | Authors: Meng Junhua | Species: rat | Application: WB - Resatorvid Relieves Breast Cancer Complicated with Depression by Inactivating Hippocampal Microglia Through TLR4/NF-κB/NLRP3 Signaling Pathway.
Journal: Cancer Manag Res | Authors: Weixu Luo | Species: mouse | Application: WB - Hepatoprotective effects of ethyl pyruvate against CCl4-induced hepatic fibrosis via inhibition of TLR4/NF-κB signaling and up-regulation of MMPs/TIMPs ratio.
Journal: Clin Res Hepatol Gastroenterol | Authors: Mingxiao Zhang | Species: rat | Application: IHC - Antihepatofibrotic effect of Guizhifuling pill on carbon tetrachloride-induced liver fibrosis in mice
Journal: J Tradit Chin Med | Authors: X U Baogui | Species: mouse | Application: WB - Hepatoprotective effects of ethyl pyruvate against CCl4-induced hepatic fibrosis via inhibition of TLR4/NF-κB signaling and up-regulation of MMPs/TIMPs ratio.
Journal: Clin Res Hepatol Gastroenterol | Authors: Mingxiao Zhang | Species: rat | Application: IHC - Dendrobium officinale polysaccharides alleviate atopic dermatitis in vivo and in vitro through inhibition of inflammation and mitochondrial dysfunction.
Journal: J Mol Histol | Authors: Bijun Zeng | Species: mouse,human | Application: WB,IF - Antihepatofibrotic effect of Guizhifuling pill on carbon tetrachloride-induced liver fibrosis in mice
Journal: J Tradit Chin Med | Authors: X U Baogui | Species: mouse | Application: WB - The LINC00365/SCGB2A1 (Mammaglobin B) Axis Down-Regulates NF-κB Signaling and Is Associated with the Progression of Gastric Cancer.
Journal: Cancer Manag Res | Authors: Xiao-Yu Yan | Species: human | Application: IF - Pseudorabies virus UL13 primes inflammatory response through downregulating heat shock factor 1
Journal: Virology | Authors: Wen-Jing Zhang | Species: human | Application: WB - Electroacupuncture restores intestinal mucosal barrier through TLR4/NF-κB p65 pathway in functional dyspepsia-like rats.
Journal: Anat Rec (Hoboken) | Authors: Dan Wang | Species: rat | Application: WB - Network pharmacology and molecular docking study on the effect of Kaempferol in treatment of metabolic associated fatty liver disease
Journal: J Tradit Chin Med | Authors: Zhou Kaixuan | Species: human | Application: WB - The LINC00365/SCGB2A1 (Mammaglobin B) Axis Down-Regulates NF-κB Signaling and Is Associated with the Progression of Gastric Cancer.
Journal: Cancer Manag Res | Authors: Xiao-Yu Yan | Species: human | Application: IF - Alpinia oxyphylla Miq. volatile oil ameliorates depressive behaviors and inhibits neuroinflammation in CUMS-exposed mice by inhibiting the TLR4-medicated MyD88/NF-κB signaling pathway
Journal: J Chem Neuroanat | Authors: Bo Wu | Species: Mouse | Application: WB - Microcystin-LR induces lung injury in mice through the NF-κB/NLRP3 pathway
Journal: J Toxicol Environ Health A | Authors: Yin Zhang | Species: mouse | Application: WB - Effect of temperature on acute kidney injury in a rat model of renal ischemia‒reperfusion
Journal: Cryobiology | Authors: Jing Mei | Species: rat | Application: WB,IHC - Dendrobium officinale polysaccharides alleviate atopic dermatitis in vivo and in vitro through inhibition of inflammation and mitochondrial dysfunction.
Journal: J Mol Histol | Authors: Bijun Zeng | Species: mouse,human | Application: WB,IF - Angiopoietin-2 Promotes Mechanical Stress-induced Extracellular Matrix Degradation in Annulus Fibrosus Via the HIF-1α/NF-κB Signaling Pathway
Journal: Orthop Surg | Authors: Xiang Ao | Species: mouse | Application: WB - Iridoids with Genipin Stem Nucleus Inhibit Lipopolysaccharide-Induced Inflammation and Oxidative Stress by Blocking the NF-κB Pathway in Polycystic Ovary Syndrome.
Journal: Cell Physiol Biochem | Authors: Tao Zuo | Species: mouse | Application: WB,IF - Monocyte-derived extracellular vesicles upon treated by palmitate promote endothelial migration and monocytes attachment to endothelial cells.
Journal: Biochem Biophys Res Commun | Authors: Wanhao Gao | Species: human | Application: WB - Salvianolic Acid B-Alleviated Angiotensin II Induces Cardiac Fibrosis by Suppressing NF-κB Pathway In Vitro.
Journal: Med Sci Monit | Authors: Chunhua Wang | Species: rat | Application: WB - Atractylenolide III suppresses senescence-associated secretome via inhibiting cGAS/NF-κB pathway in hepatic stellate cells
Journal: Clin Exp Pharmacol Physiol | Authors: Hongyan Wu | Species: human | Application: WB - Mechanisms of Qing-Shen-Du formula in treating diabetic kidney disease: Integrating network pharmacology, molecular docking, molecular dynamics, transcriptomics, and experimental validation.
Journal: J Chromatogr B Analyt Technol Biomed Life Sci | Authors: Jie Zhao | Species: rat,human | Application: WB - Mechanisms of Qing-Shen-Du formula in treating diabetic kidney disease: Integrating network pharmacology, molecular docking, molecular dynamics, transcriptomics, and experimental validation.
Journal: J Chromatogr B Analyt Technol Biomed Life Sci | Authors: Jie Zhao | Species: rat,human | Application: WB - Monocyte-derived extracellular vesicles upon treated by palmitate promote endothelial migration and monocytes attachment to endothelial cells.
Journal: Biochem Biophys Res Commun | Authors: Wanhao Gao | Species: human | Application: WB - FGF5 protects heart from sepsis injury by attenuating cardiomyocyte pyroptosis through inhibiting CaMKII/NFκB signaling
Journal: Biochem Biophys Res Commun | Authors: Shengyu Cui | Species: mouse | Application: IF - Atractylenolide III suppresses senescence-associated secretome via inhibiting cGAS/NF-κB pathway in hepatic stellate cells
Journal: Clin Exp Pharmacol Physiol | Authors: Hongyan Wu | Species: human | Application: WB - Inhibition of DNA Methyltransferase DNMT1 Reverses Th2 Response Polarisation and Alleviates Allergic Rhinitis
Journal: Clin Exp Pharmacol Physiol | Authors: Peng Zou | Species: mouse | Application: WB - Alpha-solanine inhibits endothelial inflammation via nuclear factor kappa B signaling pathway
Journal: Adv Clin Exp Med | Authors: Nan Wang | Species: human | Application: WB - CEACAM1 Inhibited IκB-α/NF-κB Signal Pathway Via Targeting MMP-9/TIMP-1 Axis in Diabetic Atherosclerosis.
Journal: J Cardiovasc Pharmacol | Authors: Jie Yu | Species: rat,human | Application: WB - The methyltransferase METTL3 regulates endothelial cell proliferation and inflammation via m6A RNA methylation-mediated TRAF1 expression
Journal: Biochem Biophys Res Commun | Authors: Duchu Chen | Species: human | Application: WB - Study on the mechanism of cardiomyocyte energy metabolism regulated by Echinocystic acid derivative in improving myocardial ischemia-reperfusion injury.
Journal: Biochem Biophys Res Commun | Authors: Yunlu Ding | Species: rat | Application: WB - Atractylenolide III suppresses senescence-associated secretome via inhibiting cGAS/NF-κB pathway in hepatic stellate cells
Journal: Clin Exp Pharmacol Physiol | Authors: Hongyan Wu | Species: human | Application: WB - Exosomes Derived From Calycosin-Exposed Prostate Stromal Cells Inhibit Lipopolysaccharide-Induced Epithelial Cells Inflammatory Injury
Journal: Am J Reprod Immunol | Authors: Ming Li | Species: human | Application: WB - Iridoids with Genipin Stem Nucleus Inhibit Lipopolysaccharide-Induced Inflammation and Oxidative Stress by Blocking the NF-κB Pathway in Polycystic Ovary Syndrome.
Journal: Cell Physiol Biochem | Authors: Tao Zuo | Species: mouse | Application: WB,IF - Aerobic exercise improves intestinal mucosal barrier dysfunction through TLR4/MyD88/NF-κB signaling pathway in diabetic rats
Journal: Biochem Biophys Res Commun | Authors: Jianping Li | Species: rat | Application: WB - The analgesic effect of electroacupuncture in alleviating paclitaxel-induced peripheral neuropathic pain and its possible mechanism relates to TLR4/P2X7-NLRP3 signaling pathway.
Journal: Purinergic Signal | Authors: Yuan-xi Zhou | Species: mouse | Application: WB - Salvianolic Acid B-Alleviated Angiotensin II Induces Cardiac Fibrosis by Suppressing NF-κB Pathway In Vitro.
Journal: Med Sci Monit | Authors: Chunhua Wang | Species: rat | Application: WB - Proteasome Inhibitor Carbobenzoxy-L-Leucyl-L-Leucyl-L-Leucinal (MG132) Enhances Therapeutic Effect of Paclitaxel on Breast Cancer by Inhibiting Nuclear Factor (NF)-κB Signaling.
Journal: Med Sci Monit | Authors: Yunjing Zhang | Species: human | Application: WB - The methyltransferase METTL3 regulates endothelial cell proliferation and inflammation via m6A RNA methylation-mediated TRAF1 expression
Journal: Biochem Biophys Res Commun | Authors: Duchu Chen | Species: human | Application: WB - BIRC3 activates NF-κB to drive TNF-α-induced endothelial dysfunction in atherosclerosis.
Journal: Biochem Biophys Res Commun | Authors: Yongchun Cai - FFA4 inhibits bleomycin-induced pulmonary fibrosis in mice by suppressing IL-33.
Journal: Biochem Biophys Res Commun | Authors: Jingjing Feng | Species: mouse | Application: WB - Alpha-Lipoic Acid Protects Human Aortic Endothelial Cells Against H2O2-Induced Injury and Inhibits Atherosclerosis in Ovariectomized Low Density Lipoprotein Receptor Knock-Out Mice.
Journal: Cell Physiol Biochem | Authors: Dachuan Shen | Species: human | Application: WB,IHC,IF - ATPIF1 alleviates oxygen glucose deprivation/reoxygenation-induced astrocyte injury in vitro: A rat model of ischemic brain injury
Journal: Adv Clin Exp Med | Authors: Zhijie Wei | Application: WB - Salvianolic Acid B-Alleviated Angiotensin II Induces Cardiac Fibrosis by Suppressing NF-κB Pathway In Vitro.
Journal: Med Sci Monit | Authors: Chunhua Wang | Species: rat | Application: WB - Interleukin-18 binding protein attenuates lipopolysaccharide-induced acute lung injury in mice via suppression NF-κB and activation Nrf2 pathway.
Journal: Biochem Biophys Res Commun | Authors: Li-Ming Zhang | Species: mouse | Application: WB - Iridoids with Genipin Stem Nucleus Inhibit Lipopolysaccharide-Induced Inflammation and Oxidative Stress by Blocking the NF-κB Pathway in Polycystic Ovary Syndrome.
Journal: Cell Physiol Biochem | Authors: Tao Zuo | Species: mouse | Application: WB,IF - Proteasome Inhibitor Carbobenzoxy-L-Leucyl-L-Leucyl-L-Leucinal (MG132) Enhances Therapeutic Effect of Paclitaxel on Breast Cancer by Inhibiting Nuclear Factor (NF)-κB Signaling.
Journal: Med Sci Monit | Authors: Yunjing Zhang | Species: human | Application: WB - Study on the mechanism of cardiomyocyte energy metabolism regulated by Echinocystic acid derivative in improving myocardial ischemia-reperfusion injury.
Journal: Biochem Biophys Res Commun | Authors: Yunlu Ding | Species: rat | Application: WB - Interleukin-18 binding protein attenuates lipopolysaccharide-induced acute lung injury in mice via suppression NF-κB and activation Nrf2 pathway.
Journal: Biochem Biophys Res Commun | Authors: Li-Ming Zhang | Species: mouse | Application: WB - FFA4 inhibits bleomycin-induced pulmonary fibrosis in mice by suppressing IL-33.
Journal: Biochem Biophys Res Commun | Authors: Jingjing Feng | Species: mouse | Application: WB - Water-separated part of Chloranthus serratus alleviates lipopolysaccharide- induced RAW264.7 cell injury mainly by regulating the MAPK and Nrf2/HO-1 inflammatory pathways.
Journal: BMC Complement Altern Med | Authors: Shuping Sun | Species: mouse | Application: WB - SIRT4 inhibits the proliferation, migration, and invasion abilities of thyroid cancer cells by inhibiting glutamine metabolism.
Journal: Onco Targets Ther | Authors: Zhouxun Chen | Species: human | Application: WB - Saturated fatty acids activate the inflammatory signalling pathway in Schwann cells: Implication in sciatic nerve injury.
Journal: Scand J Immunol | Authors: Dan Xu | Species: rat | Application: WB - Resveratrol glycoside inhibits NLRP3/IL-1β/NF-κB to alleviate peritoneal fibrosis in peritoneal dialysis
Journal: Clin Exp Nephrol | Authors: Kanghan Liu | Species: rat | Application: WB - Luteolin protects crucian carp against Aeromonas hydrophila by modulating inflammation-apoptosis axis.
Journal: Dev Comp Immunol | Authors: Jingjing Xu - Novel Recombinant Protein FlaA N/C Protects against Radiation Injury via NF-κB Signaling.
Journal: Radiat Res | Authors: Ying Xu | Species: mouse | Application: WB - ITGBL1 promotes EMT, invasion and migration by activating NF-κB signaling pathway in prostate cancer.
Journal: Onco Targets Ther | Authors: Wenze Li | Species: human | Application: WB - LRG1 promotes the apoptosis of pulmonary microvascular endothelial cells through KLK10 in chronic obstructive pulmonary disease
Journal: Tob Induc Dis | Authors: Wei Cheng | Species: mouse | Application: IHC,IF - Luteolin protects crucian carp against Aeromonas hydrophila by modulating inflammation-apoptosis axis.
Journal: Dev Comp Immunol | Authors: Jingjing Xu - NF-κB affected the serum levels of TNF-α and IL-1β via activation of the MAPK/NF-κB signaling pathway in rat model of acute pulmonary microthromboembolism
Journal: Pulm Circ | Authors: Yanfen Zhong | Species: rat | Application: IHC - SIRT4 inhibits the proliferation, migration, and invasion abilities of thyroid cancer cells by inhibiting glutamine metabolism.
Journal: Onco Targets Ther | Authors: Zhouxun Chen | Species: human | Application: WB - Effects of daphnetin on the mechanism of epithelial-mesenchymal transition induced by HMGB1 in human lung adenocarcinoma cells (A549 cell line)
Journal: Biotechnol Genet Eng Rev | Authors: Shu-Qi Gong | Species: human | Application: WB - Observation of inflammation and macrophage polarization in an experimental model of cigarette smoke-exposed mice and cigarette smoke extract (CSE)-induced RAW264.7 cells: An experimental preclinical study.
Journal: Tob Induc Dis | Authors: Jiazhen Zhao - Target NF-κB p65 for preventing posttraumatic joint contracture in rats
Journal: J Orthop Res | Authors: Lingpeng Kong | Species: rat | Application: IHC - Platelet-rich plasma improves cyclophosphamide-induced interstitial cystitis in rat models through the toll-like receptor 4/nuclear factor-kappa B signalling pathway
Journal: Clin Exp Nephrol | Authors: Yufan Wu | Species: rat | Application: WB,IF - LINC01534/miR-135b-5p/PTPRT axis regulates inflammatory response in loosening total hip replacement via modulating NF-κB signaling pathway.
Journal: Injury | Authors: Yaling Zhang | Species: human | Application: WB - NF-κB affected the serum levels of TNF-α and IL-1β via activation of the MAPK/NF-κB signaling pathway in rat model of acute pulmonary microthromboembolism
Journal: Pulm Circ | Authors: Yanfen Zhong | Species: rat | Application: IHC - Resveratrol glycoside inhibits NLRP3/IL-1β/NF-κB to alleviate peritoneal fibrosis in peritoneal dialysis
Journal: Clin Exp Nephrol | Authors: Kanghan Liu | Species: rat | Application: WB - LRG1 promotes the apoptosis of pulmonary microvascular endothelial cells through KLK10 in chronic obstructive pulmonary disease
Journal: Tob Induc Dis | Authors: Wei Cheng | Species: mouse | Application: IHC,IF - MiR-92a contributes to the cardiovascular disease development in diabetes mellitus through NF-κB and downstream inflammatory pathways.
Journal: Eur Rev Med Pharmacol Sci | Authors: W-Y Wang | Species: human | Application: WB - Dendrobium officinale Kimura et Migo attenuates diabetic cardiomyopathy through inhibiting oxidative stress, inflammation and fibrosis in streptozotocin-induced mice.
Journal: Biomed Pharmacother | Authors: Zhihao Zhang | Species: mouse | Application: WB - Platelet-rich plasma alleviates knee arthritis in rats by inhibiting p65
Journal: Cell Tissue Bank | Authors: Feng Zhuo | Species: rat | Application: WB - Suppression of TLR4 dimerization by terahertz irradiation inhibits LPS-induced inflammation: A molecular dynamics study.
Journal: J Struct Biol | Authors: Sen Shang | Species: human | Application: WB - GFPT2 promotes paclitaxel resistance in epithelial ovarian cancer cells via activating NF-κB signaling pathway
Journal: Open Life Sci | Authors: Zi-Jun Xu | Species: human | Application: WB - Gingival mesenchymal stem cell-derived exosomes ameliorate human adult keratinocyte transformed cell line inflammation and apoptosis via the TLR4/NF-κB pathway.
Journal: Arch Oral Biol | Authors: Ying Tang | Species: human | Application: WB - Effects of medicine food Fructus Gardeniae on liver and kidney functions after oral administration to rats for 12 weeks.
Journal: J Food Biochem | Authors: Chunnan Li | Species: rat | Application: WB - IL1RAP Exacerbates Sepsis-Induced Pulmonary and Spleen Injury Through Regulating CD4+ T Lymphocyte Differentiation
Journal: Immunol Invest | Authors: Liou Huang | Application: WB - N-WASP knockdown upregulates inflammatory cytokines expression in human gingival fibroblasts.
Journal: Arch Oral Biol | Authors: Yijia Wang | Species: mouse | Application: IF - Effects of black tea and black brick tea with fungal growth on lowering uric acid levels in hyperuricemic mice.
Journal: J Food Biochem | Authors: Dongyin Yuan | Species: mouse | Application: WB - Reduced Proliferative Capacity and Defense against Staphylococcus aureus in Human Nasal Mucosal Epithelium Lacking ZNF365
Journal: Int Arch Allergy Immunol | Authors: Xiaoyun Du - Identification of an IL17RC missense variant in a Chinese family with multiple osteochondromas and ankylosing spondylitis.
Journal: J Hum Genet | Authors: Yingchun Zheng | Species: human | Application: WB - Antioxidant and Immunomodulatory Properties of Partially purified Exopolysaccharide from Lactobacillus Casei Isolated from Chinese Northeast Sauerkraut.
Journal: Immunol Invest | Authors: Xiaoqing Xu | Species: mouse | Application: WB - Effects of black tea and black brick tea with fungal growth on lowering uric acid levels in hyperuricemic mice.
Journal: J Food Biochem | Authors: Dongyin Yuan | Species: mouse | Application: WB - Macrophage repolarization by epigallocatechin-3-gallate via NF-κB and CREB1/HO-1.
Journal: Arch Oral Biol | Authors: Takako Ida | Species: mouse | Application: WB - Holothuria Leucospilota polysaccharides alleviate hyperlipidemia via alteration of lipid metabolism and inflammation-related gene expression
Journal: J Food Biochem | Authors: Shanshan Lu | Species: rat | Application: WB - Platelet-rich plasma alleviates knee arthritis in rats by inhibiting p65
Journal: Cell Tissue Bank | Authors: Feng Zhuo | Species: rat | Application: WB - N-WASP knockdown upregulates inflammatory cytokines expression in human gingival fibroblasts.
Journal: Arch Oral Biol | Authors: Yijia Wang | Species: mouse | Application: IF - SMARCA4 deficiency contributes to platinum resistance in non-small cell lung cancer by activating the NF-κB-BIRC2/BIRC3 signaling axis.
Journal: J Thorac Dis | Authors: Yufeng Li - Macrophage repolarization by epigallocatechin-3-gallate via NF-κB and CREB1/HO-1.
Journal: Arch Oral Biol | Authors: Takako Ida | Species: mouse | Application: WB - Adiponectin inhibits TGF-β1-induced skin fibroblast proliferation and phenotype transformation via the p38 MAPK signaling pathway
Journal: Open Life Sci | Authors: Xueling Wang | Species: human | Application: WB - Electroacupuncture: A Feasible Sirt1 Promoter Which Modulates Metainflammation in Diet-Induced Obesity Rats.
Journal: Evid Based Complement Alternat Med | Authors: Dan Luo | Species: rat | Application: WB - Alpha-Fetoprotein Regulates the Expression of Immune-Related Proteins through the NF-κB (P65) Pathway in Hepatocellular Carcinoma Cells.
Journal: J Oncol | Authors: Qiu-Ting Li | Species: human | Application: WB - Chemokine (C-C motif) ligand 18/membrane-associated 3/forkhead box O1 axis promotes the proliferation, migration, and invasion of intrahepatic cholangiocarcinoma.
Journal: Bioengineered | Authors: Chusi Wang | Species: human | Application: WB - CHL1 inhibits cell proliferation, migration and invasion by regulating the NF‑κB signaling pathway in colorectal cancer
Journal: Exp Ther Med | Authors: Ming Bao | Species: human | Application: WB - Protective effects of miR-155-5p silencing on IFN-γ-induced apoptosis and inflammation in salivary gland epithelial cells.
Journal: Exp Ther Med | Authors: Jingli Zhang | Application: IF - SARS-CoV-2 E protein-induced THP-1 pyroptosis is reversed by Ruscogenin
Journal: Biochem Cell Biol | Authors: Houda Huang | Species: human | Application: WB - Expression and role of interleukin-1β and associated biomarkers in deep vein thrombosis.
Journal: Exp Ther Med | Authors: Rouzimaimaiti Zila Pai | Species: rat | Application: WB - Echinacoside attenuates Klebsiella pneumoniae-induced pneumonia via inhibition of the TLR4/NF-κB signaling
Journal: APMIS | Authors: Mi Zhang | Species: mouse,human | Application: WB - Cinobufagin suppresses malignant progression of oral squamous cell carcinoma through inhibition of p65 nuclear translocation.
Journal: J Oral Biosci | Authors: Yi-Xiao Qin | Species: human | Application: WB - Proof-of-concept study investigating the role of S100P-RAGE in nasopharyngeal carcinoma.
Journal: Exp Ther Med | Authors: Chengyu Wang | Species: human | Application: WB - Comparison between hangeshashinto and dexamethasone for IL-1α and β-defensin 1 production by human oral keratinocytes
Journal: J Oral Biosci | Authors: Hiroyuki Hato | Species: human | Application: WB - Proof-of-concept study investigating the role of S100P-RAGE in nasopharyngeal carcinoma.
Journal: Exp Ther Med | Authors: Chengyu Wang | Species: human | Application: WB - SARS-CoV-2 E protein-induced THP-1 pyroptosis is reversed by Ruscogenin
Journal: Biochem Cell Biol | Authors: Houda Huang | Species: human | Application: WB - LncRNA AY343892 inhibits breast cancer development by positively regulating BRCA1-mediated transcription of PTEN.
Journal: Histol Histopathol | Authors: Yan Li | Species: human | Application: WB - Cinobufagin suppresses malignant progression of oral squamous cell carcinoma through inhibition of p65 nuclear translocation.
Journal: J Oral Biosci | Authors: Yi-Xiao Qin | Species: human | Application: WB - Establishment of incontinence-associated dermatitis rat models and assessment of the therapeutic effects of zinc oxide, painless skin protective film and silicone dressing.
Journal: Exp Ther Med | Authors: Guiyuan Chen | Species: rat | Application: WB - Identification of thrombomodulin as a dynamic monitoring biomarker for deep venous thrombosis evolution.
Journal: Exp Ther Med | Authors: Xi Cheng | Species: rat | Application: IF - Comparison between hangeshashinto and dexamethasone for IL-1α and β-defensin 1 production by human oral keratinocytes
Journal: J Oral Biosci | Authors: Hiroyuki Hato | Species: human | Application: WB - Exercise reduces hyperlipidemia-induced kidney damage in apolipoprotein E-deficient mice.
Journal: Exp Ther Med | Authors: Chengsi Qian | Species: mouse | Application: WB,IHC - Response surface methodology optimization extraction of polysaccharide from Lilium brownii F.E. Brown var. viridulum Baker/Longya Baihe and its biological activities.
Journal: Prep Biochem Biotechnol | Authors: Menglu Li | Species: mouse | Application: WB - Inflammatory signals induce MUC16 expression in ovarian cancer cells via NF-κB activation.
Journal: Exp Ther Med | Authors: Jie Liu | Species: human | Application: IP - GLP-1R activation ameliorated novel-object recognition memory dysfunction via regulating hippocampal AMPK/NF-κB pathway in neuropathic pain mice.
Journal: Neurobiol Learn Mem | Authors: Long-Qing Zhang | Species: mouse | Application: WB - FABP4 Mediates Inflammation to Regulate Endometrial Epithelial Cell Function During Early Gestation in Sheep
Journal: Vet Med Sci | Authors: Yan Chen | Species: sheep | Application: WB - Curcumin inhibits the growth of liver cancer by impairing myeloid-derived suppressor cells in murine tumor tissues.
Journal: Oncol Lett | Authors: Sha Tian | Species: mouse | Application: WB - Effects of antisense lncRNA PCBP1-AS1 on biological behaviors of vulvar squamous carcinoma cells by regulating TRAF5 and NF-κB expression
Journal: Transl Cancer Res | Authors: Hongyu Wang | Species: human | Application: WB - Radiobiological effects of flattening filter and flattening filter free radiotherapy x-ray on inflammatory and apoptotic pathways in cardiac and pulmonary tissues in an MCF-7 xenograft breast cancer model.
Journal: J Radiat Res | Authors: Fatih Hacımustafaoğlu - Paeoniflorin alleviates inflammation in bovine mammary epithelial cells induced by Staphylococcus haemolyticus through TLR2/NF-κB signaling pathways
Journal: Res Vet Sci | Authors: Jirao Shen | Species: bovine | Application: WB - L-Methionine inhibits 4-hydroxy-2-nonenal accumulation and suppresses inflammation in growing rats
Journal: Nutr Res Pract | Authors: Zhengxuan Wang | Species: rat | Application: WB - Ubiquitination of P53 by E3 ligase MKRN2 promotes melanoma cell proliferation.
Journal: Oncol Lett | Authors: Yiling Zhang | Species: human | Application: WB - Britanin Exhibits Potential Inhibitory Activity on Human Prostate Cancer Cell Lines Through PI3K/Akt/NF-κB Signaling Pathways
Journal: Planta Med | Authors: Qi Zeng | Species: human | Application: WB - FABP4 Mediates Inflammation to Regulate Endometrial Epithelial Cell Function During Early Gestation in Sheep
Journal: Vet Med Sci | Authors: Yan Chen | Species: sheep | Application: WB - CD13 downregulation mediated by ubenimex inhibits autophagy to overcome 5-FU resistance by disturbing the EMP3/FAK/NF-κB pathway in gastric cancer cells
Journal: Transl Cancer Res | Authors: Ting Xiu | Species: human | Application: WB - Paeoniflorin alleviates inflammation in bovine mammary epithelial cells induced by Staphylococcus haemolyticus through TLR2/NF-κB signaling pathways
Journal: Res Vet Sci | Authors: Jirao Shen | Species: bovine | Application: WB - Resveratrol induces apoptosis in SGC-7901 gastric cancer cells.
Journal: Oncol Lett | Authors: Xiaoxue Wu | Species: human | Application: WB - Radiobiological effects of flattening filter and flattening filter free radiotherapy x-ray on inflammatory and apoptotic pathways in cardiac and pulmonary tissues in an MCF-7 xenograft breast cancer model.
Journal: J Radiat Res | Authors: Fatih Hacımustafaoğlu - Isosteviol Sodium Protects Neural Cells Against Hypoxia-Induced Apoptosis Through Inhibiting MAPK and NF-κB Pathways.
Journal: J Stroke Cerebrovasc Dis | Authors: Kai-Lun Zhong | Species: mouse | Application: WB - Resveratrol induces apoptosis in SGC-7901 gastric cancer cells.
Journal: Oncol Lett | Authors: Xiaoxue Wu | Species: human | Application: WB - Alpha-lipoic acid defends homocysteine-induced endoplasmic reticulum and oxidative stress in HAECs.
Journal: Biomed Pharmacother | Authors: Huimin Hu | Species: human | Application: WB - N-acetylserotonin alleviates retinal ischemia-reperfusion injury via HMGB1/RAGE/NF-κB pathway in rats
Journal: Int J Ophthalmol | Authors: Yu-Ze Zhao | Species: rat | Application: WB - Subcutaneous administration of infliximab-attenuated silica-induced lung fibrosis.
Journal: Int J Occup Med Environ Health | Authors: Hua Zhang | Species: rat | Application: WB,IHC - Probiotic nanovesicles encapsulating baicalin: a strategy to overcome colorectal cancer
Journal: Lett Appl Microbiol | Authors: Yifan Li | Species: human | Application: WB - N-acetylserotonin alleviates retinal ischemia-reperfusion injury via HMGB1/RAGE/NF-κB pathway in rats
Journal: Int J Ophthalmol | Authors: Yu-Ze Zhao | Species: rat | Application: WB - MiR-146a-5p downregulated TRAF6/NF-κB p65 pathway to attenuate the injury of HT-22 cells induced by oxygen-glucose deprivation/reoxygenation
Journal: In Vitro Cell Dev Biol Anim | Authors: Yuan Deng | Species: mouse | Application: WB - Role of NF-κB signaling pathway in H2O2-induced oxidative stress of hiPSCs
Journal: In Vitro Cell Dev Biol Anim | Authors: Jian Qin | Species: human | Application: WB - Mechanism of Yiqi Huoxue Huatan recipe in the treatment of coronary atherosclerotic disease through network pharmacology and experiments
Journal: Medicine (Baltimore) | Authors: Hong-Tao Huang | Species: mouse | Application: WB - Obtusifolin ameliorates dry eye model in rats by reducing inflammation and blocking MAPK/NF-κB pathways
Journal: Int J Ophthalmol | Authors: Dan Zhu - Baicalin and baicalein attenuate hyperuricemic nephropathy via inhibiting PI3K/AKT/NF-κB signaling pathway
Journal: Nephrology (Carlton) | Authors: Ziyuan Liu | Species: human | Application: WB - MiR-146a-5p downregulated TRAF6/NF-κB p65 pathway to attenuate the injury of HT-22 cells induced by oxygen-glucose deprivation/reoxygenation
Journal: In Vitro Cell Dev Biol Anim | Authors: Yuan Deng | Species: mouse | Application: WB - N-acetylserotonin alleviates retinal ischemia-reperfusion injury via HMGB1/RAGE/NF-κB pathway in rats
Journal: Int J Ophthalmol | Authors: Yu-Ze Zhao | Species: rat | Application: WB - Schisantherin A alleviated alcohol-induced liver injury by the regulation of alcohol metabolism and NF- kB pathway.
Journal: Exp Anim | Authors: Bin Li | Species: mouse | Application: WB - Probiotic nanovesicles encapsulating baicalin: a strategy to overcome colorectal cancer
Journal: Lett Appl Microbiol | Authors: Yifan Li | Species: human | Application: WB - Anti-inflammatory effect of combined tetramethylpyrazine, resveratrol and curcumin in vivo.
Journal: BMC Complement Altern Med | Authors: Long Chen | Species: mouse | Application: IHC - Wharton's Jelly Mesenchymal Stem Cell-Derived Extracellular Vesicles Reduce SARS-CoV2-Induced Inflammatory Cytokines Under High Glucose and Uremic Toxin Conditions.
Journal: Stem Cells Dev | Authors: Vuong Cat Khanh | Species: human | Application: WB - Effect of Intranasal Instillation of Lipopolysaccharide on Lung Development and Its Related Mechanism in Newborn Mice.
Journal: J Interferon Cytokine Res | Authors: Yaoyao You - Schisandrin B improves cerebral ischemia and reduces reperfusion injury in rats through TLR4/NF-κB signaling pathway inhibition.
Journal: Neurol Res | Authors: Xingjuan Fan | Species: rat | Application: WB - Triptolide reduces salivary gland damage in a non-obese diabetic mice model of Sjögren's syndrome via JAK/STAT and NF-κB signaling pathways.
Journal: J Clin Biochem Nutr | Authors: Yunke Guo | Species: mouse | Application: WB - Machine learning identifies a DNA repair-related risk model for bladder cancer and functionally characterizes ZWINT as a potential oncogenic factor.
Journal: Transl Androl Urol | Authors: Shijie Liang | Species: human | Application: WB - The effect of miR‑155‑5p on long‑term memory of sleep‑deprived mice through the BDNF/NF‑κB pathway
Journal: Acta Neurobiol Exp (Wars) | Authors: Dan Hou | Species: mouse | Application: WB - Normothermic Machine Perfusion Combined with Bone Marrow Mesenchymal Stem Cells Improves the Oxidative Stress Response and Mitochondrial Function in Rat Donation After Circulatory Death Livers.
Journal: Stem Cells Dev | Authors: Liu Yang | Species: rat | Application: WB - Clonorchis sinensis ferritin heavy chain triggers free radicals and mediates inflammation signaling in human hepatic stellate cells.
Journal: Parasitol Res | Authors: Qiang Mao | Species: human | Application: WB - Maresin-1 suppresses IL-1β-induced MMP-13 secretion by activating the PI3K/AKT pathway and inhibiting the NF-κB pathway in synovioblasts of an osteoarthritis rat model with treadmill exercise.
Journal: Connect Tissue Res | Authors: Jinghan Lu | Species: rat | Application: WB - Long noncoding RNA ANRIL knockdown attenuates neuroinflammation following ischemic stroke via suppressing the expression of NF-κB in vitro and in vivo.
Journal: Neurol Res | Authors: Ling Deng | Species: mouse | Application: WB,IF - Apelin-overexpressing neural stem cells in conjunction with a silk fibroin nanofiber scaffold for the treatment of traumatic brain injury
Journal: Stem Cells Dev | Authors: Tianwen Li | Species: mouse | Application: WB - Effect of Intranasal Instillation of Lipopolysaccharide on Lung Development and Its Related Mechanism in Newborn Mice.
Journal: J Interferon Cytokine Res | Authors: Yaoyao You - Apelin-overexpressing neural stem cells in conjunction with a silk fibroin nanofiber scaffold for the treatment of traumatic brain injury
Journal: Stem Cells Dev | Authors: Tianwen Li | Species: mouse | Application: WB - Maresin-1 suppresses IL-1β-induced MMP-13 secretion by activating the PI3K/AKT pathway and inhibiting the NF-κB pathway in synovioblasts of an osteoarthritis rat model with treadmill exercise.
Journal: Connect Tissue Res | Authors: Jinghan Lu | Species: rat | Application: WB - Xiao-Chai-Hu Decoction Ameliorates Poly (I:C)-Induced Viral Pneumonia through Inhibiting Inflammatory Response and Modulating Serum Metabolism.
Journal: Evid Based Complement Alternat Med | Authors: Feng Chen | Species: mouse | Application: WB - Zanthoxylum bungeanum Seed Oil Attenuates LPS-Induced BEAS-2B Cell Activation and Inflammation by Inhibiting the TLR4/MyD88/NF- κ B Signaling Pathway
Journal: Evid Based Complement Alternat Med | Authors: Jing Hou | Species: human | Application: IF - Guanxinping Tablets Inhibit ET-1-Induced Proliferation and Migration of MOVAS by Suppressing Activated PI3K/Akt/NF-κB Signaling Cascade.
Journal: Evid Based Complement Alternat Med | Authors: Ying-Ying Wu | Species: rat | Application: WB,IF - Yixintongmai Inhibits Proliferation and Migration and Promotes Apoptosis of Vascular Smooth Muscle Cells Cultured with High Glucose.
Journal: Evid Based Complement Alternat Med | Authors: Jingjing Guo | Species: rat | Application: WB - Zanthoxylum bungeanum Seed Oil Attenuates LPS-Induced BEAS-2B Cell Activation and Inflammation by Inhibiting the TLR4/MyD88/NF- κ B Signaling Pathway
Journal: Evid Based Complement Alternat Med | Authors: Jing Hou | Species: human | Application: IF - Curcumol Undermines SDF-1α/CXCR4/NF-κB Signaling Pathway to Suppress the Progression of Chronic Atrophic Gastritis (CAG) and Gastric Cancer
Journal: Evid Based Complement Alternat Med | Authors: Xuehui Ma | Species: rat,human | Application: WB,IHC - Xiao-Chai-Hu Decoction Ameliorates Poly (I:C)-Induced Viral Pneumonia through Inhibiting Inflammatory Response and Modulating Serum Metabolism.
Journal: Evid Based Complement Alternat Med | Authors: Feng Chen | Species: mouse | Application: WB - Guanxinping Tablets Inhibit ET-1-Induced Proliferation and Migration of MOVAS by Suppressing Activated PI3K/Akt/NF-κB Signaling Cascade.
Journal: Evid Based Complement Alternat Med | Authors: Ying-Ying Wu | Species: rat | Application: WB,IF - Suppression of high-mobility group box 1 ameliorates xerostomia in a sjogren syndrome-triggered mouse model.
Journal: Can J Physiol Pharmacol | Authors: Di Wang | Species: mouse | Application: WB - Echinacoside alleviates airway remodeling and inflammation in an ovalbumin-induced neonatal mouse model of asthma by modulating the SIRT1-NF-κB pathway
Journal: Allergol Immunopathol (Madr) | Authors: Yunbo Pan | Species: Mouse - Triamcinolone acetonide induces the autophagy of Ag85B-treated WI-38 cells via SIRT1/FOXO3 pathway
Journal: Allergol Immunopathol (Madr) | Authors: Li Luo | Species: Human - Estrogen-related Receptor α (ERRα) Functions in The Hypoxic Injury of Microglial Cells.
Journal: J Vet Res | Authors: Chao-Yang Deng | Species: mouse | Application: WB - Chemerin promotes microangiopathy in diabetic retinopathy via activation of ChemR23 in rat primary microvascular endothelial cells.
Journal: Mol Vis | Authors: Li Jun | Species: rat | Application: WB - Salvianolic acid B attenuates diabetic nephropathy through alleviating ADORA2B, NALP3 in flammasome, and NFκB activity.
Journal: Can J Physiol Pharmacol | Authors: Ching Wang | Species: mouse,human | Application: WB,IHC,IF - Nephropathy II Decoction Attenuates Renal Fibrosis via Regulating TLR4 and Gut Microbiota Along the Gut-Kidney Axis
Journal: Biol Pharm Bull | Authors: Chen Liu | Species: mouse | Application: WB - Therapeutic effects of paeoniflorin on irritable bowel syndrome in rats
Journal: J Vet Sci | Authors: Lei Wang | Species: rat | Application: WB - Echinacoside alleviates airway remodeling and inflammation in an ovalbumin-induced neonatal mouse model of asthma by modulating the SIRT1-NF-κB pathway
Journal: Allergol Immunopathol (Madr) | Authors: Yunbo Pan | Species: Mouse - Chemerin promotes microangiopathy in diabetic retinopathy via activation of ChemR23 in rat primary microvascular endothelial cells.
Journal: Mol Vis | Authors: Li Jun | Species: rat | Application: WB - Nephropathy II Decoction Attenuates Renal Fibrosis via Regulating TLR4 and Gut Microbiota Along the Gut-Kidney Axis
Journal: Biol Pharm Bull | Authors: Chen Liu | Species: mouse | Application: WB - Suppression of high-mobility group box 1 ameliorates xerostomia in a sjogren syndrome-triggered mouse model.
Journal: Can J Physiol Pharmacol | Authors: Di Wang | Species: mouse | Application: WB - Porcine parvovirus nonstructural protein NS1 activates NF-κB and it involves TLR2 signaling pathway.
Journal: J Vet Sci | Authors: Xiaohui Jin | Species: human | Application: WB,IF - Ketamine attenuates high-glucose-mediated endothelial inflammation in human umbilical vein endothelial cells.
Journal: Can J Physiol Pharmacol | Authors: Tianhai Wang | Species: human | Application: WB - A novel large animal model of posttraumatic osteoarthritis induced by inflammation with mechanical stability
Journal: Am J Transl Res | Authors: Changqi Sun | Species: pig | Application: IHC - Ketamine attenuates high-glucose-mediated endothelial inflammation in human umbilical vein endothelial cells.
Journal: Can J Physiol Pharmacol | Authors: Tianhai Wang | Species: human | Application: WB - Effects of intragastric administration of La2O3 nanoparticles on mouse testes.
Journal: J Toxicol Sci | Authors: Lu Yuan | Species: mouse | Application: WB,IHC - Renal ischemia-reperfusion injury attenuated by splenic ischemic preconditioning.
Journal: Eur Rev Med Pharmacol Sci | Authors: Y Shen | Species: rat | Application: WB - Selection and Characterization of a DNA Aptamer Recognizing High Mobility Group Box 1 Protein (HMGB1) and Enhancing Its Pro-inflammatory Activity
Journal: Iran J Pharm Res | Authors: Hanchao Li | Species: human | Application: IF - Dendrobium officinale Polysaccharide Promotes Infected Wound Healing Through SIRT1-Regulated HMGB1-K29 Deacetylation and NF-κB Inhibition.
Journal: Iran J Pharm Res | Authors: Yutong Wu | Species: mouse | Application: WB - Selection and Characterization of a DNA Aptamer Recognizing High Mobility Group Box 1 Protein (HMGB1) and Enhancing Its Pro-inflammatory Activity
Journal: Iran J Pharm Res | Authors: Hanchao Li | Species: human | Application: IF - Chronic intermittent hypoxia vs chronic continuous hypoxia: Effects on vascular endothelial function and myocardial contractility.
Journal: Clin Hemorheol Microcirc | Authors: Jing Zhu | Species: rat | Application: WB - Dendrobium officinale Polysaccharide Promotes Infected Wound Healing Through SIRT1-Regulated HMGB1-K29 Deacetylation and NF-κB Inhibition.
Journal: Iran J Pharm Res | Authors: Yutong Wu | Species: mouse | Application: WB - Immunomodulatory effects of bacterial lysates on the IL-17 signaling pathway in an asthma mouse model.
Journal: J Asthma | Authors: Mimi Gao | Species: mouse | Application: WB - 1,25-Dihydroxvitamin D3 attenuates the damage of human immortalised keratinocytes caused by Ultraviolet-B
Journal: Cutan Ocul Toxicol | Authors: Pingwei Wang | Species: human | Application: WB - Fish-oil emulsion (omega-3 polyunsaturated fatty acids) attenuates acute lung injury induced by intestinal ischemia-reperfusion through Adenosine 5'-monophosphate-activated protein kinase-sirtuin1 pathway.
Journal: J Surg Res | Authors: Jing Huirong H | Species: rat | Application: WB - Etomidate increases mortality in septic rats through inhibition of nuclear factor kappa-B rather than by causing adrenal insufficiency.
Journal: J Surg Res | Authors: Yu Zhang | Species: rat | Application: WB - Tanshinone IIA attenuates airway inflammation and airway remodeling in bronchial asthma by inhibiting p38/NF-κB and AKT/HIF-1α.
Journal: J Asthma | Authors: Weijie Yu | Species: mouse | Application: IHC - Immunomodulatory effects of bacterial lysates on the IL-17 signaling pathway in an asthma mouse model.
Journal: J Asthma | Authors: Mimi Gao | Species: mouse | Application: WB - Protective effects of sodium humate on the intestinal barrier damage of Salmonella Typhimurium-challenged broilers
Journal: Anim Sci J | Authors: Weiming Ma | Species: chicken | Application: WB - Fish-oil emulsion (omega-3 polyunsaturated fatty acids) attenuates acute lung injury induced by intestinal ischemia-reperfusion through Adenosine 5'-monophosphate-activated protein kinase-sirtuin1 pathway.
Journal: J Surg Res | Authors: Jing Huirong H | Species: rat | Application: WB - Oleuropein ameliorated lung ischemia-reperfusion injury by inhibiting TLR4 signaling cascade in alveolar macrophages.
Journal: Transpl Immunol | Authors: Zhe Xu | Species: mouse | Application: WB - Ferulic Acid Alleviates Hepatic Lipid Accumulation and Inflammation by Improving Proximal and Distal Intestinal Barriers in NAFLD Mice
Journal: Tohoku J Exp Med | Authors: Jiaojiao Fu - Protective effect of Apelin/APJ system on lipopolysaccharide-related cardiac dysfunction.
Journal: Gen Physiol Biophys | Authors: Junli Hu | Species: mouse | Application: WB - Astaxanthin ameliorates allergic rhinitis via suppression of the HMGB1/TLR4 signaling pathway.
Journal: Cent Eur J Immunol | Authors: Xixi Lei | Species: mouse | Application: WB - Influence and molecular mechanism of cinnamaldehyde against ventricular arrhythmia via the TAK1-p38MAPK-NLRP3 pathway
Journal: Heart Vessels | Authors: Guoping Ma | Species: rat | Application: WB - Tle1 attenuates hepatic ischemia/reperfusion injury by suppressing NOD2/NF-κB signaling.
Journal: Biosci Biotechnol Biochem | Authors: Wei Chen | Species: mouse | Application: WB - Plumbagin attenuated oxygen-glucose deprivation/reoxygenation-induced injury in human SH-SY5Y cells by inhibiting NOX4-derived ROS-activated NLRP3 inflammasome.
Journal: Biosci Biotechnol Biochem | Authors: Qianrui Zhang | Species: human | Application: WB - Astaxanthin ameliorates allergic rhinitis via suppression of the HMGB1/TLR4 signaling pathway.
Journal: Cent Eur J Immunol | Authors: Xixi Lei | Species: mouse | Application: WB - Tetrandrine Improves Ventricular Remodeling and Inflammation via Inhibition of the MAPK/NF-κB Pathway
Journal: Int Heart J | Authors: Yu Wang | Species: rat,mouse | Application: WB - Decreased miR-218-5p Levels as a Serum Biomarker in Bone Metastasis of Prostate Cancer.
Journal: Oncol Res Treat | Authors: Peng Peng | Species: human | Application: WB - Nuclear Factor Kappa-B/Homeobox A9-Mediated Modulation of Leucine-Rich Repeat Flightless-Interacting Protein 1 Is Involved in Advanced Glycation End Product-Induced Endothelial Dysfunction.
Journal: J Vasc Res | Authors: Qianqian Zhu | Species: human | Application: WB - Dioscin ameliorates peritoneal fibrosis by inhibiting epithelial-to-mesenchymal transition of human peritoneal mesothelial cells via the TLR4/MyD88/NF-κB signaling pathway.
Journal: Int J Clin Exp Pathol | Authors: Qiuyuan Shao | Species: human | Application: WB - MiR-181c-5p ameliorates learning and memory in sleep-deprived mice via HMGB1/TLR4/NF-κB pathway
Journal: An Acad Bras Cienc | Authors: Yujie Hu | Species: mouse | Application: WB - The Immunomodulatory Effects and Mechanisms of Tim-3 Action in the Early Stage of Mice with Severe Acute Pancreatitis.
Journal: Iran J Immunol | Authors: Min Lin | Species: mouse | Application: WB - HIV-1 Tat protein-mediated inflammatory response inhibits the erythroid hematopoietic support function of bone marrow mesenchymal stem cells
Journal: AIDS Res Hum Retroviruses | Authors: Xiaoli Wang | Species: human | Application: WB - Astaxanthin attenuated hyperuricemia and kidney inflammation by inhibiting uric acid synthesis and the NF-κ B/NLRP3 signaling pathways in potassium oxonate and hypoxanthine-induced hyperuricemia mice.
Journal: Pharmazie | Authors: Jiangchao Zhuang | Species: mouse | Application: WB - Effect of quercetin on aconitine-induced renal interstitial fibrosis and its relationship with PI3K/Akt pathway.
Journal: Pak J Pharm Sci | Authors: Wei Feng - Asprosin promotes vascular inflammation via TLR4-NFκB-mediated NLRP3 inflammasome activation in hypertension
Journal: Heliyon | Authors: Rui Ge | Species: rat,mouse | Application: WB - Oral kanglaite injection (KLTI) attenuates the lung cancer-promoting effect of high-fat diet (HFD)-induced obesity.
Journal: Oncotarget | Authors: Ning Cao | Species: mouse | Application: WB - Baicalin reduces inflammation to inhibit lung cancer via targeting SOCS1/NF-κB/STAT3 axis
Journal: Heliyon | Authors: Lijuan Guo | Species: mouse,human | Application: WB - The extract from Portulaca oleracea L. rehabilitates skin photoaging via adjusting miR-138-5p/Sirt1-mediated inflammation and oxidative stress
Journal: Heliyon | Authors: Liping Qu | Species: mouse,human | Application: WB - The role of FGF-21 in promoting diabetic wound healing by modulating high glucose-induced inflammation
Journal: Heliyon | Authors: Zheling Li | Species: mouse | Application: IHC - Modulation of EGR1 Expression by Hyperglycemia in Swine Rotator Cuff Tendons.
Journal: J Orthop Sports Med | Authors: Joey Day | Species: pig | Application: WB,IHC - ZNF545 suppresses human hepatocellular carcinoma growth by inhibiting NF-kB signaling.
Journal: Genes Cancer | Authors: Weili Yang | Species: human | Application: WB - C-X3-C motif chemokine ligand 1/receptor 1 regulates the M1 polarization and chemotaxis of macrophages after hypoxia/reoxygenation injury
Journal: Chronic Dis Transl Med | Authors: Shuiming Guo | Species: mouse | Application: WB - Nucleoporin93 (Nup93) Limits Yap Activity to Prevent Endothelial Cell Senescence
Journal: bioRxiv | Authors: Tung D Nguyen | Species: human | Application: WB - Restorative effect of modified dioscorea pills on the structure of hippocampal neurovascular unit in an animal model of chronic cerebral hypoperfusion.
Journal: Heliyon | Authors: H B Li | Species: rat | Application: IHC - The protective effects of aqueous extract of Schisandra sphenanthera against alcoholic liver disease partly through the PI3K-AKT-IKK signaling pathway
Journal: Heliyon | Authors: Ding Liu | Species: rat | Application: WB - Anemoside B4 attenuates necrotic enteritis of laying hens induced by Clostridium perfringens via inhibiting NF-κB and PI3K/Akt/mTOR signalling pathways
Journal: Heliyon | Authors: Xinyue Tian | Species: human | Application: WB - Oral kanglaite injection (KLTI) attenuates the lung cancer-promoting effect of high-fat diet (HFD)-induced obesity.
Journal: Oncotarget | Authors: Ning Cao | Species: mouse | Application: WB - Baicalin reduces inflammation to inhibit lung cancer via targeting SOCS1/NF-κB/STAT3 axis
Journal: Heliyon | Authors: Lijuan Guo | Species: mouse,human | Application: WB - Restorative effect of modified dioscorea pills on the structure of hippocampal neurovascular unit in an animal model of chronic cerebral hypoperfusion.
Journal: Heliyon | Authors: H B Li | Species: rat | Application: IHC - Lysophosphatidylcholine trigger myocardial injury in diabetic cardiomyopathy via the TLR4/ZNF480/AP-1/NF-kB pathway
Journal: Heliyon | Authors: Nannan Liu | Species: mouse | Application: WB,IHC - C-X3-C motif chemokine ligand 1/receptor 1 regulates the M1 polarization and chemotaxis of macrophages after hypoxia/reoxygenation injury
Journal: Chronic Dis Transl Med | Authors: Shuiming Guo | Species: mouse | Application: WB - The protective effects of aqueous extract of Schisandra sphenanthera against alcoholic liver disease partly through the PI3K-AKT-IKK signaling pathway
Journal: Heliyon | Authors: Ding Liu | Species: rat | Application: WB - Banxia Baizhu Tianma Decoction improves posterior circulation ischemia vertigo in rats via gut microbiota and TLR4-NF-κB-MyD88 pathway.
Journal: Phytomedicine | Authors: Fangfang Huang - HMGB1-mediated endoplasmic reticulum stress in monocyte-derived dendritic cells regulates CD4+ T cell immune responses in myasthenia gravis.
Journal: J Neuroinflammation | Authors: Qing Zhang - HMGB1-mediated endoplasmic reticulum stress in monocyte-derived dendritic cells regulates CD4+ T cell immune responses in myasthenia gravis.
Journal: J Neuroinflammation | Authors: Qing Zhang - Platycodon grandiflorum and Glycyrrhiza uralensis extract attenuates cyclophosphamide-induced tracheal mucosal barrier injury in broilers by modulating gut microbiota and short-chain fatty acids.
Journal: Poult Sci | Authors: Yijie Qin - Functional consistency and molecular evolution: a comprehensive characterization of primary endometrial cancer-associated fibroblasts during in vitro expansion.
Journal: J Transl Med | Authors: Lunmin Bao - Astragalus polysaccharides alleviate LPS-induced inflammatory injury in the avian macrophage cell line HD11 via the TLR2/PI3K/AKT/NF-κB signaling pathway.
Journal: Poult Sci | Authors: Haisheng Jiang - Glucose dose-dependently modulates antimicrobial peptide genes expression through the ERK/PI3K-NF-κB/FOXO signaling in Chinese mitten crab (Eriocheir sinensis).
Journal: Fish Shellfish Immunol | Authors: Jinming Yu - Mechanism of Cinnamaldehyde in Alleviating Staphylococcus aureus-Induced Mammary Inflammatory Response.
Journal: Animals (Basel) | Authors: Xiaohui Chen - Mechanism of Cinnamaldehyde in Alleviating Staphylococcus aureus-Induced Mammary Inflammatory Response.
Journal: Animals (Basel) | Authors: Xiaohui Chen - Mechanisms of AFB1-induced neurotoxicity and protective effect of baicalin via inflammatory and antioxidant pathways in ducklings.
Journal: Poult Sci | Authors: Pu Guo - Heat stress enhances gut microbial arginine catabolism to amplify MyD88-dependent inflammatory responses.
Journal: Microbiome | Authors: Xianxi Ye | Species: mouse | Application: WB,IHC,IF - A Decoy-Receptor-Armed Biomimetic Nanotherapeutic With Inherent Tropism for Conserved Pathogenic Macrophages for Treating Osteoarthritis and Intervertebral Disc Degeneration.
Journal: Adv Sci (Weinh) | Authors: Fudong Li - FOXP1 Knockdown Reprograms Th9 CAR-T Cells to Overcome Antigen Escape.
Journal: Adv Sci (Weinh) | Authors: Yihan Zhu | Species: mouse | Application: WB - Reduning injection alleviated LPS-induced ARDS via multi-target regulation by modulating inflammation and immune responses based on target fishing technique and scRNA-seq analysis.
Journal: Phytomedicine | Authors: Si-Wen Hui - Tinosinenside A ameliorates Alzheimer's disease-related pathology in APP/PS1 mice, accompanied by reduced neuroinflammation and altered microglial phenotype-associated marker expression.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Jingjing Wang | Species: mouse | Application: WB - Reduning injection alleviated LPS-induced ARDS via multi-target regulation by modulating inflammation and immune responses based on target fishing technique and scRNA-seq analysis.
Journal: Phytomedicine | Authors: Si-Wen Hui - Compound Kushen Injection Alleviates Experimental Colitis in Mice by Regulating Macrophage Polarization through TLR4/NF-κB Signaling.
Journal: Chin J Integr Med | Authors: Di Ao | Species: mouse | Application: WB - Shengji Yuhong Ointment accelerates diabetic wound healing by suppressing AGEs/RAGE-related inflammation and restoring HIF-1α/VEGF-mediated angiogenesis.
Journal: J Ethnopharmacol | Authors: Qiang Tang - GCN5-Mediated Lactylation of YY1 Promotes Diabetic Cardiomyopathy by Activating Twist1-Dependent EndMT.
Journal: FASEB J | Authors: Jingjing Liu | Species: human | Application: WB - Transcutaneous electrical nerve stimulation improves lateral ankle sprain (LAS) in rats by regulating the CXCL10/NF-kB signaling pathway: a potential treatment for LAS.
Journal: Mol Biol Rep | Authors: Yan Sun - Uncoupling Type I Interferon Benefits From Inflammatory Toxicity: Transformer-Prioritized Precision Agonists for Potent and Safer Cancer Immunotherapy.
Journal: Adv Sci (Weinh) | Authors: Xuefei Guo - Farrerol alleviates hepatic ischemia-reperfusion injury by regulating the CD14/MyD88/NF-κB signaling pathway.
Journal: Int Immunopharmacol | Authors: Hongliang Liang | Species: mouse | Application: WB - Alisol A 23,24-diacetate improves LPS-induced acute lung injury through the IL-17A/NF-κB signaling pathway.
Journal: Chin Med | Authors: Yuhan Zhang - Investigating the therapeutic mechanism of leech in vascular dementia: An integrated approach combining network pharmacology and experimental validation.
Journal: Brain Res Bull | Authors: Yanjiao Li | Species: rat | Application: WB - Uhrf1-Mediated PKM2 Degradation via Ubiquitination Alleviates Inflammation and Pyroptosis in Inflammatory Bowel Disease.
Journal: Adv Sci (Weinh) | Authors: Juan Zhang - Fucose ameliorates aging and inflammatory injury by promoting mitophagy.
Journal: Tissue Cell | Authors: Liu Min | Species: human, mouse | Application: WB,IF - Fucose ameliorates aging and inflammatory injury by promoting mitophagy.
Journal: Tissue Cell | Authors: Liu Min | Species: human, mouse | Application: WB,IF - A stiffness-tunable 3D alginate-collagen-hyaluronic acid model reveals the matrix-dependent chondroprotection of quercetin in osteoarthritis.
Journal: Biomater Adv | Authors: Genlai Du - Lipid-conjugated siRNA targeting SARM1 enables CNS silencing and mitigates alzheimer-like phenotypes.
Journal: Bioorg Chem | Authors: Ying Cai | Species: mouse | Application: WB - Supraphysiological 25-Hydroxyvitamin D(3) and Calcipotriol Induce Reactive Oxygen Species, Mitochondrial Dysfunction and Apoptosis in HeLa Cervical Cancer Cells.
Journal: FASEB Bioadv | Authors: Hoi Ching Cherry Chan - Protective Effect of Calcitonin Gene-Related Peptide on Corneal Epithelial Barrier in Experimental Dry Eye Models.
Journal: Invest Ophthalmol Vis Sci | Authors: Jintao Shi - Yangyin Shengji Powder inhibits inflammation and promotes the wound-healing in oral ulcers through regulating SIRT1/NF-κB p65 signaling pathway.
Journal: Odontology | Authors: Hongyue Yu - Ginkgolide A alleviated liver fibrosis by modulating PI3K/AKT/NF-κB signaling to inhibit M1 macrophage polarization and macrophage-HSC crosstalk.
Journal: Int Immunopharmacol | Authors: Jingxin He - SADS-CoV nucleocapsid protein antagonizes DAD1-mediated STING activation to prevent cytosolic DNA sensing.
Journal: Cell Rep | Authors: Yuying Li - USP40 alleviates atherosclerosis by stabilizing SIRT1 to suppress endothelial apoptosis and NLRP3 inflammasome activation.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Pei Chen | Species: human | Application: WB - Regulation of LPS-induced neuroinflammation in BV-2 cells by mung bean-derived chlorophyll metal salts via the NF-κB/MAPK signaling pathway.
Journal: Food Res Int | Authors: Yuting Su - Elucidation of the immunotoxicity of PEDOT: PSS on RAW264.7 macrophages by oxidative stress, inflammatory response, and NF-κB pathway activation.
Journal: J Environ Sci (China) | Authors: Chunyu Shi - Paeoniflorin alleviates fibrosis in cows with clinical endometritis by inhibiting macrophage M1 polarization.
Journal: J Reprod Immunol | Authors: Lin Liang - Gegen Flavonoids and Huangqi Saponins Combination Ameliorates Diabetic Nephropathy By Modulating the Gut-Kidney Axis and Regulating Macrophage Polarization.
Journal: Appl Biochem Biotechnol | Authors: Yue Liu - STC1 promotes monosodium urate crystal-induced gouty inflammation via the cAMP-PKA-NF-κB/NLRP3 pathway in mice.
Journal: Cell Signal | Authors: Yue He - SOX30 Facilitates Triple-Negative Breast Cancer Metastasis via TNFR2-NF-κB Signaling and Tumor Microenvironment Remodeling.
Journal: Adv Sci (Weinh) | Authors: Pingping Gao - Tafolecimab mitigates ox-LDL-induced macrophage foam cell formation and inflammation by modulating SR-A/ABCG1 expression and inhibiting the NF-κB/MAPK pathways.
Journal: Biomed Rep | Authors: Xinyi Yu - OLR1 drives gastric cancer progression through NF-κB activation and immunosuppressive macrophage polarization.
Journal: Med Oncol | Authors: Zhimin Chen - Ginsenoside alleviates sepsis related acute lung injury by inhibiting the destruction of alveolar epithelial barrier mediated by EVs secreted by alveolar macrophages.
Journal: Int Immunopharmacol | Authors: Hao Ming - In-depth examination of the zinc-mitigation of the molecular effects of heat stress-induced intestinal damage in broilers.
Journal: Poult Sci | Authors: Yangyang Hu - A novel ligand for chicken Toll-like receptor 5 from Eimeria maxima: dihydrolipoyl dehydrogenase drives M2-like polarization and Treg-like responses.
Journal: Poult Sci | Authors: Xiaoting Sun
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
