p70(S6K) Polyclonal antibody 26587-1-AP proteintech
$149.00
In stock
SKU
26587-1-AP
| Catalog Number | 26587-1-AP |
| Synonyms | p70 alpha, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6K, p70 S6K 1, p70 S6K alpha, p70 S6KA, p70(S6K), p70(S6K) alpha, p70S6k, P70S6K1, PS6K, Ribosomal protein S6 kinase I, RPS6KB1, S6K, S6K beta 1, S6K1, STK14A |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells, A549 cells |
| Tested Applications — Positive IP detected in | A549 cells |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | MCF-7 cells, A549 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24073 Product name: Recombinant human p70(S6K) protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC053365 Sequence: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEI Predict reactive species |
| Full Name | ribosomal protein S6 kinase, 70kDa, polypeptide 1 |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 60-75 kDa |
| GenBank Accession Number | BC053365 |
| Gene Symbol | p70 S6K |
| Gene ID (NCBI) | 6198 |
| RRID | AB_2880565 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23443 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
| IHC protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
| IP protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
| WB protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
| pig | WB Am J Physiol Endocrinol Metab Prematurity blunts the feeding-induced stimulation of translation initiation signaling and protein synthesis in muscle of neonatal piglets. Authors - Jane K Naberhuis View Article |
| human | WB Sci Rep Rubidium ions as a novel therapeutic approach for glioblastoma Authors - Zairan Wang View Article |
| mouse | WB J Agric Food Chem Selenomethionine Promotes Milk Protein and Fat Synthesis and Proliferation of Mammary Epithelial Cells through the GPR37-mTOR-S6K1 Signaling Authors - Jinlong Zhang View Article |
| Citations | 3 |
| Dilutions | WB : 1:200-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RPS6KB1(Ribosomal protein S6 kinase beta-1) is also named as STK14A, p70 S6KA and belongs to the S6 kinase subfamily. RPS6KB1 is a major substrate of MTOR and acts as a crucial effector of MTOR signaling pathway. It plays a key role in cell growth and proliferation by regulating INS sensitivity, metabolism, protein synthesis, and cell cycle. RPS6KB1 may play an important role in the progression of HCC and could serve as a potential molecular target for HCC therapy (PMID:22684641). RPS6KB1 is a 70 kDa protein and has 5 isoforms with the calculated molecular mass of 51-59kDa produced by alternative initiation. Protocols Product Specific Protocols IF protocol for p70(S6K) antibody 26587-1-AP Download protocol IHC protocol for p70(S6K) antibody 26587-1-AP Download protocol IP protocol for p70(S6K) antibody 26587-1-AP Download protocol WB protocol for p70(S6K) antibody 26587-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Prematurity blunts the feeding-induced stimulation of translation initiation signaling and protein synthesis in muscle of neonatal piglets.
Journal: Am J Physiol Endocrinol Metab | Authors: Jane K Naberhuis | Species: pig | Application: WB - Rubidium ions as a novel therapeutic approach for glioblastoma
Journal: Sci Rep | Authors: Zairan Wang | Species: human | Application: WB - Selenomethionine Promotes Milk Protein and Fat Synthesis and Proliferation of Mammary Epithelial Cells through the GPR37-mTOR-S6K1 Signaling
Journal: J Agric Food Chem | Authors: Jinlong Zhang | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
