RPS27A Polyclonal antibody 14946-1-AP proteintech
$149.00
In stock
SKU
14946-1-AP
| Catalog Number | 14946-1-AP |
| Synonyms | CEP80, HUBCEP80, ribosomal protein S27a, Small ribosomal subunit protein eS31, UBA80 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse cerebellum tissue, Jurkat cells |
| Tested Applications — Positive IHC detected in | mouse cerebellum tissue, human cerebellum tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | mouse cerebellum tissue, Jurkat cells |
| Positive IHC detected in | mouse cerebellum tissue, human cerebellum tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6750 Product name: Recombinant human RPS27A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-156 aa of BC001392 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK Predict reactive species |
| Full Name | ribosomal protein S27a |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 9 kDa, 18 kDa |
| GenBank Accession Number | BC001392 |
| Gene Symbol | RPS27A |
| Gene ID (NCBI) | 6233 |
| RRID | AB_2878093 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62979 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for RPS27A antibody 14946-1-AP | Download protocol |
| IF protocol for RPS27A antibody 14946-1-AP | Download protocol |
| IHC protocol for RPS27A antibody 14946-1-AP | Download protocol |
| WB protocol for RPS27A antibody 14946-1-AP | Download protocol |
| human | IF Nat Commun Nuclear and cytoplasmic specific RNA binding proteome enrichment and its changes upon ferroptosis induction Authors - Haofan Sun View Article |
| mouse | WB Nat Commun DDX41 resolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death Authors - Honghao Bi View Article |
| Citations | 9 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:200-1:800 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A) [PMID:10772958] Protocols Product Specific Protocols FC protocol for RPS27A antibody 14946-1-AP Download protocol IF protocol for RPS27A antibody 14946-1-AP Download protocol IHC protocol for RPS27A antibody 14946-1-AP Download protocol WB protocol for RPS27A antibody 14946-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Integration of RNA-seq and ATAC-seq analyzes the effect of low dose neutron-γ radiation on gene expression of lymphocytes from oilfield logging workers
Journal: Front Chem | Authors: Weiguo Li - UBC Mediated by SEPT6 Inhibited the Progression of Prostate Cancer.
Journal: Mediators Inflamm | Authors: Ruochen Zhang | Species: human | Application: WB - Ubiquitin B in cervical cancer: critical for the maintenance of cancer stem-like cell characters.
Journal: PLoS One | Authors: Yuan Tian | Species: human | Application: WB - Nuclear and cytoplasmic specific RNA binding proteome enrichment and its changes upon ferroptosis induction
Journal: Nat Commun | Authors: Haofan Sun | Species: human | Application: IF - DDX41 dissolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death
Journal: bioRxiv | Authors: Honghao Bi | Species: mouse | Application: WB - DDX41 resolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death
Journal: Nat Commun | Authors: Honghao Bi | Species: mouse | Application: WB - UBC Mediated by SEPT6 Inhibited the Progression of Prostate Cancer.
Journal: Mediators Inflamm | Authors: Ruochen Zhang | Species: human | Application: WB - Ubiquitin B in cervical cancer: critical for the maintenance of cancer stem-like cell characters.
Journal: PLoS One | Authors: Yuan Tian | Species: human | Application: WB - DDX41 dissolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death
Journal: bioRxiv | Authors: Honghao Bi | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
