vwf Monoclonal antibody, PBS Only (Capture) 66682-4-PBS proteintech
$699.00
In stock
SKU
66682-4-PBS
| Catalog Number | 66682-4-PBS |
| Synonyms | VWF, VWFpp, F8VWF, von Willebrand antigen II, VWD |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25578 Product name: Recombinant human vwf protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 754-854 aa of Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD Predict reactive species |
| Full Name | von Willebrand factor |
| Gene Symbol | VWF |
| Gene ID (NCBI) | 7450 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P04275 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 3C12G5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
