ATF7 Polyclonal antibody 29770-1-AP proteintech
$149.00
In stock
SKU
29770-1-AP
| Catalog Number | 29770-1-AP |
| Synonyms | ATFA |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human lung tissue, mouse lung tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissue, rat lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human lung tissue, mouse lung tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissue, rat lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30882 Product name: Recombinant human ATF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-167 aa of NM_001366555 Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL Predict reactive species |
| Full Name | activating transcription factor 7 |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 52-60 kDa |
| GenBank Accession Number | NM_001366555 |
| Gene Symbol | ATF7 |
| Gene ID (NCBI) | 11016 |
| RRID | AB_3086157 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17544 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ATF7 antibody 29770-1-AP | Download protocol |
| WB protocol for ATF7 antibody 29770-1-AP | Download protocol |
| human | WB,IF Acta Pharmacol Sin CircSARS-CV2-N1368 from SARS-CoV-2 impairs endothelial cell function through the upregulation of ATF7 to activate TLR4/NF-κB/ROS signaling Authors - Yi-Hong Wen View Article |
| Citations | 1 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- CircSARS-CV2-N1368 from SARS-CoV-2 impairs endothelial cell function through the upregulation of ATF7 to activate TLR4/NF-κB/ROS signaling
Journal: Acta Pharmacol Sin | Authors: Yi-Hong Wen | Species: human | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
