ATP11B Polyclonal antibody 13672-1-AP proteintech
$149.00
In stock
SKU
13672-1-AP
| Catalog Number | 13672-1-AP |
| Synonyms | Phospholipid-transporting ATPase IF, P4-ATPase flippase complex alpha subunit ATP11B, EC:7.6.2.1, ATPIR, ATPIF |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4654 Product name: Recombinant human ATP11B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-104 aa of BC033880 Sequence: SSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRCEISLSSLCCR Predict reactive species |
| Full Name | ATPase, class VI, type 11B |
| Calculated Molecular Weight | 1177aa, 134 kDa |
| GenBank Accession Number | BC033880 |
| Gene Symbol | ATP11B |
| Gene ID (NCBI) | 23200 |
| RRID | AB_2063150 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2G3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ATP11B antibody 13672-1-AP | Download protocol |
| IHC protocol for ATP11B antibody 13672-1-AP | Download protocol |
| rat | WB Life Sci miRNA-150-5p associate with antihypertensive effect of epigallocatechin-3-gallate revealed by aorta miRNome analysis of spontaneously hypertensive rat. Authors - Bing-Jun Qian View Article |
| human,mouse | WB,IHC J Immunother Cancer Oncolytic peptide LTX-315 induces anti-pancreatic cancer immunity by targeting the ATP11B-PD-L1 axis. Authors - Tianyu Tang KO Validated View Article |
| Ruby (Verified Customer) (06-01-2025) | I never got any selective staining. Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1 in 1000 (WB), 1 in 400 (IF) Cell Tissue Type: Platelets |
| Citations | 3 |
| Dilutions | IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Loss of the heterogeneous expression of flippase ATP11B leads to cerebral small vessel disease in a normotensive rat model.
Journal: Acta Neuropathol | Authors: Sophie Quick | Species: rat | Application: IF - Oncolytic peptide LTX-315 induces anti-pancreatic cancer immunity by targeting the ATP11B-PD-L1 axis.
Journal: J Immunother Cancer | Authors: Tianyu Tang KO Validated | Species: human,mouse | Application: WB,IHC - miRNA-150-5p associate with antihypertensive effect of epigallocatechin-3-gallate revealed by aorta miRNome analysis of spontaneously hypertensive rat.
Journal: Life Sci | Authors: Bing-Jun Qian | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
