Centrin 1 Polyclonal antibody 12794-1-AP proteintech
$149.00
In stock
SKU
12794-1-AP
| Catalog Number | 12794-1-AP |
| Synonyms | CETN1, Caltractin isoform 2, CEN1, Centrin-1, CETN |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HL-60 cells, HeLa cells, human heart tissue |
| Tested Applications — Positive IF/ICC detected in | hTERT-RPE1 cells, HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HL-60 cells, HeLa cells, human heart tissue |
| Positive IF/ICC detected in | hTERT-RPE1 cells, HeLa cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3529 Product name: Recombinant human CETN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC029515 Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY Predict reactive species |
| Full Name | centrin, EF-hand protein, 1 |
| Calculated Molecular Weight | 172 aa, 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC029515 |
| Gene Symbol | Centrin 1 |
| Gene ID (NCBI) | 1068 |
| RRID | AB_2077371 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12798 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for Centrin 1 antibody 12794-1-AP | Download protocol |
| IF protocol for Centrin 1 antibody 12794-1-AP | Download protocol |
| mouse,human | WB,IF Nat Cell Biol The Cep63 paralogue Deup1 enables massive de novo centriole biogenesis for vertebrate multiciliogenesis. Authors - Huijie Zhao View Article |
| human | IF Nat Commun DNA replication licensing factor Cdc6 and Plk4 kinase antagonistically regulate centrosome duplication via Sas-6. Authors - Xiaowei Xu View Article |
| mouse | IF Nat Commun Cytoplasmic E2f4 forms organizing centres for initiation of centriole amplification during multiciliogenesis. Authors - Munemasa Mori View Article |
| zebrafish | IF Nucleic Acids Res Resting cells rely on the DNA helicase component MCM2 to build cilia. Authors - Teresa Casar Tena View Article |
| Julie (Verified Customer) (02-14-2019) | Nice staining of ciliated human fibroblasts. Applications: Immunofluorescence, Primary Antibody Dilution: 1:100 Cell Tissue Type: human fibroblasts Centrin 1 Antibody Immunofluorescence, validation (1:100 dilution) in human fibroblasts (Cat no:12794-1-AP) |
| Citations | 55 |
| Dilutions | WB : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. Protocols Product Specific Protocols WB protocol for Centrin 1 antibody 12794-1-AP Download protocol IF protocol for Centrin 1 antibody 12794-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The Cep63 paralogue Deup1 enables massive de novo centriole biogenesis for vertebrate multiciliogenesis.
Journal: Nat Cell Biol | Authors: Huijie Zhao | Species: mouse,human | Application: WB,IF - Posterior Neocortex-Specific Regulation of Neuronal Migration by CEP85L Identifies Maternal Centriole-Dependent Activation of CDK5.
Journal: Neuron | Authors: Andrew Kodani | Species: human - NudC regulates actin dynamics and ciliogenesis by stabilizing cofilin 1.
Journal: Cell Res | Authors: Cheng Zhang | Species: human | Application: IF - Cytoplasmic E2f4 forms organizing centres for initiation of centriole amplification during multiciliogenesis.
Journal: Nat Commun | Authors: Munemasa Mori | Species: mouse | Application: IF - Resting cells rely on the DNA helicase component MCM2 to build cilia.
Journal: Nucleic Acids Res | Authors: Teresa Casar Tena | Species: zebrafish | Application: IF - DNA replication licensing factor Cdc6 and Plk4 kinase antagonistically regulate centrosome duplication via Sas-6.
Journal: Nat Commun | Authors: Xiaowei Xu | Species: human | Application: IF - Competitive antagonism of KAT7 crotonylation against acetylation affects procentriole formation and colorectal tumorigenesis
Journal: Nat Commun | Authors: Meng Wang | Species: human | Application: WB,IF - Cytoplasmic E2f4 forms organizing centres for initiation of centriole amplification during multiciliogenesis.
Journal: Nat Commun | Authors: Munemasa Mori | Species: mouse | Application: IF - DNA replication licensing factor Cdc6 and Plk4 kinase antagonistically regulate centrosome duplication via Sas-6.
Journal: Nat Commun | Authors: Xiaowei Xu | Species: human | Application: IF - Uncovering structural themes across cilia microtubule inner proteins with implications for human cilia function
Journal: Nat Commun | Authors: Jens S Andersen | Species: human | Application: IF - Identification of a component of the tubulin poly-glutamylase complex required for phosphoinositide homeostasis and cilium assembly and maintenance.
Journal: Nat Commun | Authors: Binshad Badarudeen | Species: human | Application: IF - Posterior Neocortex-Specific Regulation of Neuronal Migration by CEP85L Identifies Maternal Centriole-Dependent Activation of CDK5.
Journal: Neuron | Authors: Andrew Kodani | Species: human - Resting cells rely on the DNA helicase component MCM2 to build cilia.
Journal: Nucleic Acids Res | Authors: Teresa Casar Tena | Species: zebrafish | Application: IF - NuSAP Safeguards Centriole Integrity to Mediate CEP57-CEP152 Torus Recruitment for Proper Engagement.
Journal: Adv Sci (Weinh) | Authors: Shiyu Zhang | Species: human | Application: IF - Hornerin mediates phosphorylation of the polo-box domain in Plk1 by Chk1 to induce death in mitosis
Journal: Cell Death Differ | Authors: Haiyu Song | Species: human | Application: IF - The parkin-γ-tubulin axis regulates epidermal homeostasis and is associated with the susceptibility to psoriasis.
Journal: Cell Death Differ | Authors: Yuanyuan Liu | Species: human,mouse,zebrafish | Application: IF - Cilia defects upon loss of WDR4 are linked to proteasomal hyperactivity and ubiquitin shortage
Journal: Cell Death Dis | Authors: Martin D Burkhalter | Species: human | Application: IF - Cdk1-phosphorylated Nur77 accumulates at the centrosome during mitosis to regulate the Cep192-PLK1 signaling axis.
Journal: Cell Death Dis | Authors: Guobin Xie | Species: human,mouse | Application: IF - Cell-supporting cytoskeletons and phagocytic acquisition of compatible solutes emerge as common strategies for high-salt adaptation in different ciliates
Journal: Sci China Life Sci | Authors: Fengchao Li - Centrosomal Localization of RXRα Promotes PLK1 Activation and Mitotic Progression and Constitutes a Tumor Vulnerability.
Journal: Dev Cell | Authors: Guobin Xie | Species: human | Application: IF - ASK1-Mediated Phosphorylation Blocks HDAC6 Ubiquitination and Degradation to Drive the Disassembly of Photoreceptor Connecting Cilia.
Journal: Dev Cell | Authors: Jie Ran | Species: mouse | Application: IF - Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages.
Journal: EMBO J | Authors: Kodani Andrew A | Species: mouse | Application: IF - c-Cbl Acts as an E3 Ligase Against DDA3 for Spindle Dynamics and Centriole Duplication during Mitosis.
Journal: Mol Cells | Authors: Dasom Gwon | Species: human | Application: IF - Wdr47 Controls Neuronal Polarization through the Camsap Family Microtubule Minus-End-Binding Proteins.
Journal: Cell Rep | Authors: Yawen Chen | Species: mouse - Dynamic shape-shifting of the single-celled eukaryotic predator Lacrymaria via unconventional cytoskeletal components
Journal: Curr Biol | Authors: Weiwei Qin | Application: IF - Cilia in the brain display region-dependent oscillations of length and orientation
Journal: PLoS Biol | Authors: Roudabeh Vakil Monfared | Species: mouse | Application: IF - INF2 formin variants linked to human inherited kidney disease reprogram the transcriptome, causing mitotic chaos and cell death
Journal: Cell Mol Life Sci | Authors: Leticia Labat-de-Hoz - CFAP65 is essential for C2a projection integrity in axonemes: implications for organ-specific ciliary dysfunction and infertility
Journal: Cell Mol Life Sci | Authors: Jinyi Chen | Species: mouse - CCDC15 localizes to the centriole inner scaffold and controls centriole length and integrity
Journal: J Cell Biol | Authors: Melis D Arslanhan | Species: human | Application: WB - JNK regulates ciliogenesis through the interflagellar transport complex and actin networks
Journal: J Cell Biol | Authors: Maria Chatzifrangkeskou | Application: IF - PLK4-phosphorylated NEDD1 facilitates cartwheel assembly and centriole biogenesis initiations.
Journal: J Cell Biol | Authors: Wangfei Chi | Species: human | Application: IF - Parental centrioles are dispensable for deuterosome formation and function during basal body amplification.
Journal: EMBO Rep | Authors: Huijie Zhao | Species: mouse | Application: IF - ENKD1 promotes CP110 removal through competing with CEP97 to initiate ciliogenesis.
Journal: EMBO Rep | Authors: Ting Song | Species: mouse | Application: IF - Dynamic SAS-6 phosphorylation aids centrosome duplication and elimination in C. elegans oogenesis
Journal: EMBO Rep | Authors: Feifei Qi | Application: IF - CDK2 inhibition disorders centrosome stoichiometry and alters cellular outcomes in aneuploid cancer cells
Journal: Cancer Biol Ther | Authors: Zibo Chen | Species: mouse,human | Application: IF - CCHCR1-astrin interaction promotes centriole duplication through recruitment of CEP72
Journal: BMC Biol | Authors: Zhenguang Ying | Species: human | Application: IF - CCHCR1-astrin interaction promotes centriole duplication through recruitment of CEP72
Journal: BMC Biol | Authors: Zhenguang Ying | Species: human | Application: IF - Norlichexanthone, a shunt product of Griseofulvin, disrupts spindle assembly checkpoint and nucleocytoplasmic transport by targeting TPR in the nuclear pore complex.
Journal: Bioorg Chem | Authors: Huong T. Pham - Tau tubulin kinase 1 and 2 regulate ciliogenesis and human pluripotent stem cells-derived neural rosettes
Journal: Sci Rep | Authors: Lucia Binó | Species: human | Application: IF - K-Ras Binds Calmodulin-Related Centrin1 with Potential Implications for K-Ras Driven Cancer Cell Stemness
Journal: Cancers (Basel) | Authors: Ganesh Babu Manoharan | Species: human | Application: WB - Molecular mechanisms underlying the role of the centriolar CEP164-TTBK2 complex in ciliopathies.
Journal: Structure | Authors: Ivan Rosa E Silva | Species: human | Application: IF - Cartwheel disassembly regulated by CDK1-Cyclin B kinase allows human centriole disengagement and licensing
Journal: J Biol Chem | Authors: Fan Huang | Species: human | Application: IF - PEDF regulates plasticity of a novel lipid-MTOC axis in prostate cancer-associated fibroblasts.
Journal: J Cell Sci | Authors: Francesca Nardi | Species: human | Application: IF - MICAL-L1 coordinates ciliogenesis by recruitment of EHD1 to the primary cilium.
Journal: J Cell Sci | Authors: Shuwei Xie | Species: human | Application: IF - Homozygous mutations in DZIP1 can induce asthenoteratospermia with severe MMAF.
Journal: J Med Genet | Authors: Mingrong Lv | Species: mouse,human | Application: IF - Loss of DRC1 function leads to multiple morphological abnormalities of the sperm flagella and male infertility in human and mouse.
Journal: Hum Mol Genet | Authors: Jintao Zhang | Species: human | Application: WB,IF - ciBAR1 loss in mice causes laterality defects, pancreatic degeneration, and altered glucose tolerance
Journal: Life Sci Alliance | Authors: Eunice N Kim | Species: mouse | Application: IF - Vesicular trafficking plays a role in centriole disengagement and duplication.
Journal: Mol Biol Cell | Authors: ShuweiXie | Species: human | Application: IF - Characterization of centriole biogenesis during multiciliation in planarians.
Journal: Biol Cell | Authors: Yaping Li | Application: IF - Bisphenol A disrupts mitotic progression via disturbing spindle attachment to kinetochore and centriole duplication in cancer cell lines.
Journal: Toxicol In Vitro | Authors: Seul Kim | Species: human - The tumor suppressor proteins ASPP1 and ASPP2 interact with C-Nap1 and regulate centrosome linker reassembly.
Journal: Biochem Biophys Res Commun | Authors: Yuanyuan Zhang | Species: human | Application: IF - The Cilia-Associated Protein CCDC89 Is Dispensable for Male Fertility in Mice.
Journal: Cytoskeleton (Hoboken) | Authors: Dehao Song | Species: mouse | Application: IF - Visualizing Cartwheel Disassembly Process During Mitosis in Fixed and Live Cells by Fluorescence Microscope
Journal: Methods Mol Biol | Authors: Fan Huang | Species: human | Application: IF - Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
Journal: Elife | Authors: Andrew Kodani | Species: human | Application: IF - Absence of CEP78 causes photoreceptor and sperm flagella impairments in mice and a human individual
Journal: Elife | Authors: Tianyu Zhu | Species: mouse | Application: IF - CFAP100 forms phase-separated condensates required for ciliary transition zone assembly.
Journal: Nat Commun | Authors: Shuang Sun | Species: human | Application: IF
Reviews
Write Your Own Review