ATP5L2 Monoclonal antibody, PBS Only (Detector) 60482-2-PBS proteintech
$699.00
In stock
SKU
60482-2-PBS
| Catalog Number | 60482-2-PBS |
| Synonyms | ATPase subunit g 2, ATP5K2, 4E7E8 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12841 Product name: Recombinant human ATP5L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC093719 Sequence: MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFKQLTVKEALLNGLVATEVSTWFYVREITGKRGIIG Predict reactive species |
| Full Name | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G2 pseudogene |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| GenBank Accession Number | BC093719 |
| Gene Symbol | ATP5L2 |
| Gene ID (NCBI) | 267020 |
| Conjugate | Unconjugated |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q7Z4Y8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 4E7E8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
