Angiopoietin 1 Monoclonal antibody, PBS Only 68618-1-PBS proteintech
$699.00
In stock
SKU
68618-1-PBS
| Catalog Number | 68618-1-PBS |
| Synonyms | ANGPT1, ANG-1, ANG1, ANG 1, AGPT |
| Host | Mouse |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species |
| Full Name | angiopoietin 1 |
| Calculated Molecular Weight | 498 aa, 58 kDa |
| Observed Molecular Weight | 70 kDa, 55 kDa |
| GenBank Accession Number | BC152411 |
| Gene Symbol | Angiopoietin 1 |
| Gene ID (NCBI) | 284 |
| RRID | AB_3085311 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15389 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 3C4A3 |
| Conjugation | Unconjugated |
Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
