LPCAT1 Polyclonal antibody 16112-1-AP proteintech
$149.00
In stock
SKU
16112-1-AP
| Catalog Number | 16112-1-AP |
| Synonyms | Acetyl-CoA:lyso-platelet-activating factor acetyltransferase, Acetyl-CoA:lyso-PAF acetyltransferase, 1-alkylglycerophosphocholine O-acetyltransferase, 1-alkenylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphocholine O-acyltransferase |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A431 cells, human lung tissue, mouse spleen tissue, mouse brain tissue, rat brain tissue, A549 cells, mouse lung tissue, rat lung tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, mouse spleen tissue, mouse lung tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A431 cells, HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | A431 cells, human lung tissue, mouse spleen tissue, mouse brain tissue, rat brain tissue, A549 cells, mouse lung tissue, rat lung tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue, mouse spleen tissue, mouse lung tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells, HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9035 Product name: Recombinant human LPCAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-395 aa of BC020166 Sequence: IKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD Predict reactive species |
| Full Name | lysophosphatidylcholine acyltransferase 1 |
| Calculated Molecular Weight | 534 aa, 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC020166 |
| Gene Symbol | LPCAT1 |
| Gene ID (NCBI) | 79888 |
| RRID | AB_2135554 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NF37 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for LPCAT1 antibody 16112-1-AP | Download protocol |
| IHC protocol for LPCAT1 antibody 16112-1-AP | Download protocol |
| IP protocol for LPCAT1 antibody 16112-1-AP | Download protocol |
| WB protocol for LPCAT1 antibody 16112-1-AP | Download protocol |
| human | WB Front Immunol Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma Authors - Jinfeng Zhu KD Validated View Article |
| HUMAN | WB Curr Biol Neutral lipid stores and lipase PNPLA5 contribute to autophagosome biogenesis. Authors - Nicolas Dupont View Article |
| Citations | 54 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
LPCAT1, also named as AYTL2, PFAAP3 and LysoPAFAT, belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. It is a key enzyme for remodeling phospholipids, including phosphatidylcholine. The expression level of LPCAT1 is able to differentiate prostate cancer from noncancerous prostatic changes, and correlates to the tumor grade of prostate cancer. LPCAT1 possesses both acyltransferase and acetyltransferase activities. It mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Protocols Product Specific Protocols IF protocol for LPCAT1 antibody 16112-1-AP Download protocol IHC protocol for LPCAT1 antibody 16112-1-AP Download protocol IP protocol for LPCAT1 antibody 16112-1-AP Download protocol WB protocol for LPCAT1 antibody 16112-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Oncogene Amplification in Growth Factor Signaling Pathways Renders Cancers Dependent on Membrane Lipid Remodeling.
Journal: Cell Metab | Authors: Junfeng Bi KD Validated | Species: human | Application: WB,IHC - Lysophosphatidylcholine acyltransferase 1 altered phospholipid composition and regulated hepatoma progression.
Journal: J Hepatol | Authors: Morita Yoshifumi Y KD Validated | Species: human | Application: WB - Neutral lipid stores and lipase PNPLA5 contribute to autophagosome biogenesis.
Journal: Curr Biol | Authors: Nicolas Dupont | Species: HUMAN | Application: WB - Regulation of stem cell function and neuronal differentiation by HERV-K via mTOR pathway.
Journal: Proc Natl Acad Sci U S A | Authors: Tongguang Wang KD Validated | Species: human | Application: WB,IF - Human embryonic lung epithelial tips are multipotent progenitors that can be expanded in vitro as long-term self-renewing organoids.
Journal: Elife | Authors: Marko Z Nikolić | Species: human | Application: IHC - Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma
Journal: Front Immunol | Authors: Jinfeng Zhu KD Validated | Species: human | Application: WB - Anti-EGFR ScFv functionalized exosomes delivering LPCAT1 specific siRNAs for inhibition of lung cancer brain metastases
Journal: J Nanobiotechnology | Authors: Jun Jiang | Species: human,mouse | Application: WB,IF - Lysophosphatidylcholine acyltransferase 1 upregulation and concomitant phospholipid alterations in clear cell renal cell carcinoma.
Journal: J Exp Clin Cancer Res | Authors: Yiqing Du | Species: human | Application: WB,IHC - Leukemia-expanded splenic CD81+ erythroblasts potentiate disease progression in mice by reshaping leukemic cell metabolism.
Journal: J Clin Invest | Authors: Yue Li | Species: mouse | Application: WB - LPCAT1 promotes brain metastasis of lung adenocarcinoma by up-regulating PI3K/AKT/MYC pathway.
Journal: J Exp Clin Cancer Res | Authors: Chunhua Wei | Species: human | Application: WB,IHC - Tumor-Specific Delivery of CD28 siRNA via Lyso-PC C-16 Modified Lipid Nanoparticles Overcomes Anti-PD-1 Resistance by Remodeling Tumor Microenvironment.
Journal: Adv Sci (Weinh) | Authors: Yangyang Chai | Species: mouse | Application: WB - HIF-2α/LPCAT1 orchestrates the reprogramming of lipid metabolism in ccRCC by modulating the FBXW7-mediated ubiquitination of ACLY
Journal: Int J Biol Sci | Authors: Mintian Fei | Species: human | Application: WB - Disorder of phospholipid metabolism in the renal cortex and medulla contributes to acute tubular necrosis in mice after cantharidin exposure using integrative lipidomics and spatial metabolomics
Journal: J Pharm Anal | Authors: Tianmu He | Species: human | Application: WB - Lysophosphatidylcholine acyltransferase 1 promotes head and neck squamous cell carcinoma progression by enhancing COX17-dependent oxidative phosphorylation.
Journal: Cell Death Discov | Authors: Yuanyang Zhao | Species: human | Application: WB,IHC - Regulation of stem cell function and neuronal differentiation by HERV-K via mTOR pathway.
Journal: Proc Natl Acad Sci U S A | Authors: Tongguang Wang | Species: human | Application: WB,IF - LRRK2 reduces the sensitivity to TKI and PD-1 blockade in ccRCC via activating LPCAT1
Journal: Oncogene | Authors: Yulong Hong | Species: human | Application: WB,IHC,CoIP - Comprehensive pancancer analysis reveals that LPCAT1 is a novel predictive biomarker for prognosis and immunotherapy response
Journal: Apoptosis | Authors: Hongyu Gao | Species: human | Application: WB - Multiomics analysis reveals the potential of LPCAT1-PC axis as a therapeutic target for human intervertebral disc degeneration
Journal: Int J Biol Macromol | Authors: Xi Chen | Species: human | Application: IHC - Effects of platelet-activating factor and its differential regulation by androgens and steroid hormones in prostate cancers.
Journal: Br J Cancer | Authors: Xu B B | Species: human | Application: WB,IHC - Neutral lipid stores and lipase PNPLA5 contribute to autophagosome biogenesis.
Journal: Curr Biol | Authors: Nicolas Dupont | Species: HUMAN | Application: WB - The prognostic value of the GPAT/AGPAT gene family in hepatocellular carcinoma and its role in the tumor immune microenvironment
Journal: Front Immunol | Authors: Peizhen Wen | Species: human | Application: WB,IHC - Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma
Journal: Front Immunol | Authors: Jinfeng Zhu | Species: human | Application: WB - FGF9 and FGF10 activate distinct signaling pathways to direct lung epithelial specification and branching.
Journal: Sci Signal | Authors: Yongjun Yin | Species: mouse | Application: IHC - Chemical profile of Swertia mussotii Franch and its potential targets against liver fibrosis revealed by cross-platform metabolomics.
Journal: J Ethnopharmacol | Authors: Ya Zhang | Species: mouse | Application: WB - Integration of multi-omics and machine learning to reveal the anti-osteoporosis effects of Hederagenin by inhibiting lipid peroxidation via the GPX4/p-STAT1/PTGS2 axis.
Journal: Biochem Pharmacol | Authors: Junliang Lu | Species: mouse | Application: WB - Arginase 1 and L-arginine coordinate fetal lung development and the initiation of labor in mice
Journal: EMBO Rep | Authors: Yaqin Yu | Species: human | Application: IF,IHC - Up-regulation of lysophosphatidylcholine acyltransferase 1 (LPCAT1) is linked to poor prognosis in breast cancer
Journal: Aging (Albany NY) | Authors: Patrick Lebok | Species: human | Application: IHC - KL-6 assisted subtyping of ARDS: from subtype-specific metabolomics to LPCAT1 as a pathogenic target.
Journal: Respir Res | Authors: Xiaowen Wang | Species: human, mouse | Application: WB - Hypericin alleviates depression via the microbiota-gut-brain Axis: Role of Akkermansia muciniphila and glycerophospholipid metabolism.
Journal: Eur J Pharmacol | Authors: Xiaoya Li | Species: mouse | Application: WB,IHC - Alteration in Lysophospholipids and Converting Enzymes in Glaucomatous Optic Nerves.
Journal: Invest Ophthalmol Vis Sci | Authors: Sasha M Milbeck | Species: human | Application: WB - Lysophosphatidylcholine Acyltransferase 1-Phosphatidylcholine Axis Protects Nucleus Pulposus Cells From Ferroptosis by Facilitating Lysosomal Repair via Interaction With the Endoplasmic Reticulum.
Journal: Neurospine | Authors: Chuanfu Li | Species: human | Application: WB,IHC - LPCAT1 depletion inhibits colorectal cancer tumorigenesis and is associated with the ECM-receptor-interaction signaling pathway.
Journal: Sci Rep | Authors: Liping Jiang | Species: human | Application: WB,IHC - Lysophosphatidylcholine acyltransferase 2 (LPCAT2) co-localises with TLR4 and regulates macrophage inflammatory gene expression in response to LPS.
Journal: Sci Rep | Authors: W Abate | Species: mouse | Application: WB - Biomimetic nanoparticles coated with ScFv-modified macrophage membranes for siRNA delivery to relieve brain metastases of lung cancer.
Journal: BMC Biotechnol | Authors: Yuan Lu | Species: human | Application: WB - LPCAT1, the Enzyme Responsible for Converting LPC to PC, Promotes OPC Differentiation In Vitro
Journal: J Cell Mol Med | Authors: Qi Shang | Species: mouse | Application: WB - Lysophosphatidylcholine acyltransferase 1 alleviates silica-induced pulmonary fibrosis by modulating lipid metabolism
Journal: Biomed Pharmacother | Authors: Xuedan Deng | Species: mouse | Application: IHC,WB - High lysophosphatidylcholine acyltransferase 1 expression independently predicts high risk for biochemical recurrence in prostate cancers.
Journal: Mol Oncol | Authors: Grupp Katharina K | Species: human | Application: IHC - The expression level of lysophosphatidylcholine acyltransferase 1 (LPCAT1) correlates to the progression of prostate cancer.
Journal: Exp Mol Pathol | Authors: Zhou Xinchun X | Species: human | Application: IHC - Upregulation of LPGAT1 Enhances Lung Adenocarcinoma Proliferation
Journal: Front Biosci (Landmark Ed) | Authors: Huiyuan Gong | Species: human | Application: WB - LPCAT1 Specifically Interacts with StarD10 to Facilitate Surfactant Phospholipid Trafficking in Alveolar Type II Cells.
Journal: J Biol Chem | Authors: Sui Lin | Species: mouse | Application: WB, IF - Reduction in Synaptic Vesicle Protein Abundance but Increased Amounts of Nsg2 and Lpcat1 in Cerebral Cortices Without the Endosomal SNARE Proteins Vti1a and Vti1b.
Journal: Proteomics | Authors: Julia Gottschalk | Species: mouse | Application: WB - Lung epithelial tip progenitors integrate Glucocorticoid and STAT3-mediated signals to control progeny fate.
Journal: Development | Authors: Usua Laresgoiti | Species: mouse | Application: IF - Overexpression of Lysophosphatidylcholine Acyltransferase 1 and Concomitant Lipid Alterations in Gastric Cancer.
Journal: Ann Surg Oncol | Authors: Takashi Uehara | Species: human - Novel Prognostic Signatures of Hepatocellular Carcinoma Based on Metabolic Pathway Phenotypes.
Journal: Front Oncol | Authors: Tingbo Ye | Species: human | Application: IHC - The expression of Toll-like receptor 4, 7 and co-receptors in neurochemical sub-populations of rat trigeminal ganglion sensory neurons.
Journal: Neuroscience | Authors: Martin P Helley | Species: rat | Application: WB, IF - Increased lysophosphatidylcholine acyltransferase 1 expression is unrelated to prognosis of esophageal cancer patients.
Journal: J Cancer Res Clin Oncol | Authors: Eugen Bellon | Species: human | Application: IHC - Polypeptide N-acetylgalactosaminyltransferase 18 Retains in Endoplasmic Reticulum Depending on its Luminal Regions Interacting with ER resident UGGT1, PLOD3 and LPCAT1.
Journal: Glycobiology | Authors: Wenjuan Jia | Species: human | Application: WB - Molecular mechanisms regulating lysophosphatidylcholine acyltransferase 1 (LPCAT1) in human pregnancy.
Journal: Placenta | Authors: Neeraja Purandare | Species: mouse | Application: IF, WB - Neonatal exposure to sevoflurane induces adolescent neurobehavioral dysfunction by interfering with hippocampal glycerophoslipid metabolism in rats.
Journal: Cereb Cortex | Authors: Yonghai Wang | Species: rat | Application: WB,IF - Age-Associated Lipidome Changes in Metaphase II Mouse Oocytes.
Journal: PLoS One | Authors: Hyuck Jun Mok | Species: mouse | Application: WB - Lysophosphatidylcholine Acyltransferase1 Overexpression Promotes Oral Squamous Cell Carcinoma Progression via Enhanced Biosynthesis of Platelet-Activating Factor.
Journal: PLoS One | Authors: Tomomi Shida-Sakazume | Species: human | Application: WB, IHC - The inhibition of Aurora A kinase regulates phospholipid remodeling by upregulating LPCAT1 in glioblastoma
Journal: Neoplasma | Authors: Ya-Zhou Miao | Application: IHC - Phosphatidylcholine Metabolism Controls Alveolar Progenitor Renewal and Pulmonary Fibrosis.
Journal: bioRxiv | Authors: Anas Rabata | Species: human, mouse | Application: IF - Human embryonic lung epithelial tips are multipotent progenitors that can be expanded in vitro as long-term self-renewing organoids.
Journal: Elife | Authors: Marko Z Nikolić | Species: human | Application: IHC
Reviews
Write Your Own Review