CHAC1 Polyclonal antibody 15207-1-AP proteintech
$149.00
In stock
SKU
15207-1-AP
| Catalog Number | 15207-1-AP |
| Synonyms | Blocks Notch protein, Botch, Cation transport regulator-like protein 1, EC:4.3.2.7, Gamma-GCG 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat, hamster and More (2) |
| Reactivity | human, mouse, rat, hamster, chicken, yeast |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, A549 cells, CHO cells, U-251 cells, C6 cells, RAW 264.7 cells |
| Tested Applications — Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, A549 cells, CHO cells, U-251 cells, C6 cells, RAW 264.7 cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat, hamster |
| Cited Reactivity | human, mouse, rat, chicken, yeast |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7360 Product name: Recombinant human CHAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC001847 Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV Predict reactive species |
| Full Name | ChaC, cation transport regulator homolog 1 (E. coli) |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001847 |
| Gene Symbol | CHAC1 |
| Gene ID (NCBI) | 79094 |
| RRID | AB_2878118 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BUX1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CHAC1 antibody 15207-1-AP | Download protocol |
| WB protocol for CHAC1 antibody 15207-1-AP | Download protocol |
| mouse | WB Cell Mol Gastroenterol Hepatol Hepatic TGFβr1 Deficiency Attenuates Lipopolysaccharide/D-Galactosamine-Induced Acute Liver Failure Through Inhibiting GSK3β-Nrf2-Mediated Hepatocyte Apoptosis and Ferroptosis. Authors - Sha Huang View Article |
| human | WB Lung ETS1 Ameliorates Hyperoxia-Induced Bronchopulmonary Dysplasia in Mice by Activating Nrf2/HO-1 Mediated Ferroptosis Authors - Min Yang View Article |
| Zach (Verified Customer) (08-29-2025) | Pretty great experience with this antibody, gave a prominent and specific band between 25-35kDa in models of acute pancreatitis. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: pancreas, acinar cells |
| Citations | 55 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CHAC1(Cation transport regulator-like protein 1) was identified in a co-regulated group of genes enriched for components of the ATF4 (activating transcription factor 4) arm of the unfolded protein response pathway. CHAC1 is a proapoptotic ER stress protein downstream of the pancreatic EIF2α kinase-ATF4 pathway that appears to be important for human physiology and disease(PMID: 19109178). In addition, the study found that high CHAC1 expression is associated with a bad prognosis hinting that CHAC1 may have a possible prognostic significance in breast cancer(PMID: 35930144). The predicted molecular weight of CHAC1 is 24 kDa, and the molecular weight detected by Proteintech is 38 kDa (PMID: 39368995). Protocols Product Specific Protocols IHC protocol for CHAC1 antibody 15207-1-AP Download protocol WB protocol for CHAC1 antibody 15207-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Consequences of poly(ethylene oxide) and poloxamer P188 on transcription in healthy and stressed myoblasts
Journal: Proc Natl Acad Sci U S A | Authors: Adelyn A Crabtree | Application: WB - Hepatic TGFβr1 Deficiency Attenuates Lipopolysaccharide/D-Galactosamine-Induced Acute Liver Failure Through Inhibiting GSK3β-Nrf2-Mediated Hepatocyte Apoptosis and Ferroptosis.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Sha Huang | Species: mouse | Application: WB - High-fat diet aggravates colitis-associated carcinogenesis by evading ferroptosis in the ER stress-mediated pathway.
Journal: Free Radic Biol Med | Authors: Xiaoli Zhang | Species: human | Application: WB - miR-210-3p Ameliorates Metabolic Dysfunction-Associated Steatohepatitis-Related Fibrosis by Targeting ISCU and Induces Ferroptosis
Journal: Liver Int | Authors: Zixing Dai - Astragalin promotes HSCs ferroptosis through NCOA4 mediated ferritinophagy to alleviate liver fibrosis in zebrafish and mice
Journal: Commun Biol | Authors: Yuhua Wang - ETS1 Ameliorates Hyperoxia-Induced Bronchopulmonary Dysplasia in Mice by Activating Nrf2/HO-1 Mediated Ferroptosis
Journal: Lung | Authors: Min Yang | Species: human | Application: WB - Amino acid restriction sensitizes lung cancer cells to ferroptosis via GCN2-dependent activation of the integrated stress response.
Journal: Redox Biol | Authors: Viktor Antonsson Garellick | Species: human | Application: WB - Protein S-glutathionylation confers cellular resistance to ferroptosis induced by glutathione depletion
Journal: Redox Biol | Authors: Yi Ju | Species: mouse,human | Application: WB,IHC - Anti-CHAC1 exosomes for nose-to-brain delivery of miR-760-3p in cerebral ischemia/reperfusion injury mice inhibiting neuron ferroptosis
Journal: J Nanobiotechnology | Authors: Yong Wang | Species: mouse | Application: WB,IF - CHAC1 blockade suppresses progression of lung adenocarcinoma by interfering with glucose metabolism via hijacking PKM2 nuclear translocation
Journal: Cell Death Dis | Authors: Junfan Pan | Species: mouse,human | Application: WB,IP,IHC,IF - Dual inhibition of thioredoxin reductase and proteasome is required for auranofin-induced paraptosis in breast cancer cells
Journal: Cell Death Dis | Authors: Min Ji Seo | Species: human | Application: WB - Febuxostat therapy improved the outcomes of cardiorenal syndrome rodent through alleviating xanthine oxidase-induced oxidative stress and mitochondrial dysfunction
Journal: Int J Biol Sci | Authors: Chih-Chao Yang | Species: rat | Application: WB,IHC,IF - Juglone induces ferroptotic effect on hepatocellular carcinoma and pan-cancer via the FOSL1-HMOX1 axis
Journal: Phytomedicine | Authors: Chuyu Wang | Species: human | Application: WB - E7386 enhances lenvatinib's antitumor activity in preclinical models and human hepatocellular carcinoma
Journal: Clin Cancer Res | Authors: Agavni Mesropian | Application: IHC - ChaC1-based drug screenings identify a synergistic lethal effect of auranofin and proteasome inhibitors in hepatocellular carcinoma cells.
Journal: Cell Death Discov | Authors: Cheng Yu | Species: human | Application: WB - Consequences of poly(ethylene oxide) and poloxamer P188 on transcription in healthy and stressed myoblasts
Journal: Proc Natl Acad Sci U S A | Authors: Adelyn A Crabtree | Application: WB - Cancer associated fibroblast secreted miR-432-5p targets CHAC1 to inhibit ferroptosis and promote acquired chemoresistance in prostate cancer
Journal: Oncogene | Authors: Jun Zhao | Species: human | Application: WB - The PERK-eIF2α-ATF4 Axis Is Involved in Mediating ER-Stress-Induced Ferroptosis via DDIT4-mTORC1 Inhibition and Acetaminophen-Induced Hepatotoxicity
Journal: Antioxidants (Basel) | Authors: Thu-Hang Thi Nghiem | Species: mouse | Application: WB - Hepatic TGFβr1 Deficiency Attenuates Lipopolysaccharide/D-Galactosamine-Induced Acute Liver Failure Through Inhibiting GSK3β-Nrf2-Mediated Hepatocyte Apoptosis and Ferroptosis.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Sha Huang | Species: mouse | Application: WB - Metformin rescues osteoblast fate in Glucocorticoid-associated osteonecrosis of the femoral head via PERK/CHAC1/GSH-mediated reprogramming of glutathione homeostasis.
Journal: Free Radic Biol Med | Authors: Yannan Cheng - High-fat diet aggravates colitis-associated carcinogenesis by evading ferroptosis in the ER stress-mediated pathway.
Journal: Free Radic Biol Med | Authors: Xiaoli Zhang | Species: human | Application: WB - Methionine metabolism is linked with phospholipid and glutamine metabolism to drive ferroptosis.
Journal: Cell Rep | Authors: Jong Woo Kim | Species: mouse | Application: WB - Glaucocalyxin A impairs tumor growth via amplification of the ATF4/CHOP/CHAC1 cascade in human oral squamous cell carcinoma.
Journal: J Ethnopharmacol | Authors: Xin Wang | Species: human | Application: WB,IHC,IF - Salidroside ameliorates acetaminophen-induced acute liver injury through the inhibition of endoplasmic reticulum stress-mediated ferroptosis by activating the AMPK/SIRT1 pathway
Journal: Ecotoxicol Environ Saf | Authors: Jun Xu | Species: mouse | Application: WB - Cynarin alleviates acetaminophen-induced acute liver injury through the activation of Keap1/Nrf2-mediated lipid peroxidation defense via the AMPK/SIRT3 signaling pathway.
Journal: Food Funct | Authors: Luying Zhao | Species: mouse | Application: WB - miR-210-3p Ameliorates Metabolic Dysfunction-Associated Steatohepatitis-Related Fibrosis by Targeting ISCU and Induces Ferroptosis
Journal: Liver Int | Authors: Zixing Dai - Astragalin promotes HSCs ferroptosis through NCOA4 mediated ferritinophagy to alleviate liver fibrosis in zebrafish and mice
Journal: Commun Biol | Authors: Yuhua Wang - Whole transcriptome profiling reveals a lncMDP1 that regulates myogenesis by adsorbing miR-301a-5p targeting CHAC1
Journal: Commun Biol | Authors: Bingjie Chen | Species: chicken | Application: WB - TEC-mediated tRF-31R9J regulates histone lactylation and acetylation by HDAC1 to suppress hepatocyte ferroptosis and improve non-alcoholic steatohepatitis
Journal: Clin Epigenetics | Authors: Juanjuan Zhu | Application: WB - CHAC1 as a Novel Contributor of Ferroptosis in Retinal Pigment Epithelial Cells with Oxidative Damage
Journal: Int J Mol Sci | Authors: Ye Liu | Species: human | Application: IF - Novel insights into the protective effects of leonurine against acute kidney injury: Inhibition of ER stress-associated ferroptosis via regulating ATF4/CHOP/ACSL4 pathway
Journal: Chem Biol Interact | Authors: Ran Cheng | Species: mouse,human | Application: WB - Xylitol acts as an anticancer monosaccharide to induce selective cancer death via regulation of the glutathione level.
Journal: Chem Biol Interact | Authors: Nahoko Tomonobu | Species: human | Application: WB - Shengqing Jiangzhuo Capsule Alleviates Intestinal Inflammation in Chronic Kidney Disease by Downregulating CHAC1 to Inactivate the HIF-1 Pathway.
Journal: Mediators Inflamm | Authors: Zhibin Li | Species: rat,human | Application: WB - Mechanism of Saikosaponin D in regulating ferroptosis in patient-derived lung adenocarcinoma organoids via upregulation of ATF3/CHOP/CHAC1 signaling.
Journal: Sci Rep | Authors: Jia Li | Species: human | Application: WB - Ferroptosis-related gene NOX4, CHAC1 and HIF1A are valid biomarkers for stomach adenocarcinoma.
Journal: J Cell Mol Med | Authors: Ruoxi Xiao | Species: human | Application: IHC - Ferroptosis-related gene CHAC1 is a valid indicator for the poor prognosis of kidney renal clear cell carcinoma.
Journal: J Cell Mol Med | Authors: Deng Li | Species: human | Application: WB,IHC - Vitamin D3 and its active form calcitriol suppress erythroleukemia through upregulation of CHAC1 and downregulation of NOTCH1
Journal: Med Oncol | Authors: Jiankun Hong | Species: human | Application: WB - NUPR1 alleviates renal ischemia reperfusion injury by inhibiting ferroptosis involving the ATF4-CHAC1 pathway.
Journal: Cell Signal | Authors: Yanwen Luo | Species: mouse,human | Application: WB - Ferroptosis-related gene CHAC1 is a valid indicator for the poor prognosis of kidney renal clear cell carcinoma.
Journal: J Cell Mol Med | Authors: Deng Li | Species: human | Application: WB,IHC - Prognostic Values of Ferroptosis-Related Proteins ACSL4, SLC7A11, and CHAC1 in Cholangiocarcinoma
Journal: Biomedicines | Authors: Supakan Amontailak | Species: human | Application: IHC - ETS1 Ameliorates Hyperoxia-Induced Bronchopulmonary Dysplasia in Mice by Activating Nrf2/HO-1 Mediated Ferroptosis
Journal: Lung | Authors: Min Yang | Species: human | Application: WB - p53 Activates the Lipoxygenase Activity of ALOX15B via Inhibiting SLC7A11 to Induce Ferroptosis in Bladder Cancer Cells
Journal: Lab Invest | Authors: Xurui Li | Species: human | Application: WB - HIF-mediated regulation of glutathione-specific gamma-glutamyl cyclotransferase 1 contributes to tubular cell death in renal ischemia-reperfusion.
Journal: Am J Physiol Renal Physiol | Authors: Yoshitaka Kihira | Species: mouse,human | Application: WB,IHC - Dot1l Regulates the Spontaneous Bone Regeneration of Periosteum-Derived Stem Cells by Regulating Chac1 Expression
Journal: Stem Cells Int | Authors: Taoran Jiang | Species: human | Application: WB - Brusatol hinders the progression of bladder cancer by Chac1/Nrf2/SLC7A11 pathway
Journal: Exp Cell Res | Authors: X I Yu | Species: mouse,human | Application: WB,IHC - Metabolomic analysis of spontaneous neutrophil apoptosis reveals the potential involvement of glutathione depletion.
Journal: Innate Immun | Authors: Xiong Yuyun | Species: mouse | Application: WB - Treatment with paraquat affects the expression of ferroptosis-related genes
Journal: Hum Exp Toxicol | Authors: Xiaogang Ge | Species: mouse | Application: WB - Development and validation of an endoplasmic reticulum stress-related molecular prognostic model for breast cancer
Journal: Front Oncol | Authors: Pengyu Fan | Species: human | Application: WB - Unraveling the molecular mechanisms of paraquat toxicity: The interplay of ATF4, ferroptosis, and endoplasmic reticulum stress
Journal: Food Chem Toxicol | Authors: Jingjing Ke | Species: mouse,human | Application: WB - DJ-1 inhibits glutathione degradation by downregulating CHAC1 expression in astrocytes
Journal: Neurosci Res | Authors: Yuan Ge | Species: mouse | Application: WB - Rhein Prevents APAP-induced drug-induced Liver Injury by Upregulating Nrf2 and Inhibiting APAP-activating Enzymes.
Journal: Cell Biochem Biophys | Authors: Mingda Liu | Species: mouse | Application: WB - Differences in cell death in methionine versus cysteine depletion.
Journal: Environ Mol Mutagen | Authors: Katherine F Wallis | Species: human | Application: WB - ChaC1 upregulation reflects poor prognosis in a variety of cancers: analysis of the major missense SNPs of ChaC1 as an aid to refining prognosis
Journal: Gene | Authors: Devraj Parande | Species: yeast | Application: WB - SGLT2 inhibitor downregulated oxidative stress via activating AMPK pathway for cardiorenal (CR) protection in CR syndrome rodent fed with high protein diet
Journal: J Mol Histol | Authors: Chih-Chao Yang | Species: rat | Application: IHC,IF - Dissecting Complex Interactions Between Ferroptosis and the Proteasome.
Journal: bioRxiv | Authors: Magdalena B. Murray | Species: human | Application: WB
Reviews
Write Your Own Review