Mouse Atox1 Recombinant monoclonal antibody, PBS Only (Capture) 84305-1-PBS proteintech
$699.00
In stock
SKU
84305-1-PBS
| Catalog Number | 84305-1-PBS |
| Synonyms | 241566A7, Atx1, HAH1 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35290 Product name: Recombinant mouse Atox1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of NM_009720 Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK Predict reactive species |
| Full Name | ATX1 (antioxidant protein 1) homolog 1 (yeast) |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 7 kDa |
| GenBank Accession Number | NM_009720 |
| Gene Symbol | Atox1 |
| Gene ID (NCBI) | 11927 |
| RRID | AB_3671846 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O08997 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241566A7 |
| Conjugation | Unconjugated |
Antioxidant 1 copper chaperone (Atox1) is a small cytosolic protein containing an MBS (metal binding site) and a potential NLS (nuclear localisation signal). It plays an essential role in copper homeostasis by facilitating the transfer of copper to the trans-Golgi. Atox1 has been implicated in a wide range of diseases, including many neurodegenerative, cancer and metabolic disorders.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
