BACH2 Polyclonal antibody 27635-1-AP proteintech
$149.00
In stock
SKU
27635-1-AP
| Catalog Number | 27635-1-AP |
| Synonyms | BACH2, BTB and CNC homolog 2 |
| Host | Rabbit |
| Reactivity | Human and More (1) |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Daudi cells, Ramos cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Positive WB detected in | Daudi cells, Ramos cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26526 Product name: Recombinant human BACH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-235 aa of NM_001170794 Sequence: MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ Predict reactive species |
| Full Name | BTB and CNC homology 1, basic leucine zipper transcription factor 2 |
| Calculated Molecular Weight | 93 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | NM_001170794 |
| Gene Symbol | BACH2 |
| Gene ID (NCBI) | 60468 |
| RRID | AB_2880934 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYV9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for BACH2 antibody 27635-1-AP | Download protocol |
| human | WB Antioxid Redox Signal Zinc Protoporphyrin Functions as a Ferroptosis Inducer to Activate Heme-BACH Axis and Potently Suppress IDH1-Mutant Gliomas. Authors - Ying Yang View Article |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
BACH2, also named as Transcription regulator protein BACH2, is a 841 amino acid protein, which is widely expressed within the B-lymphoid lineage, except in plasma cells. BACH2 contains an N-terminal BTB domain involved in its transcriptional function, but instead of having zinc fingers at the C-terminus, it binds to DNA through a basic leucine zipper motif. BACH2 binds DNA consensus sequences, termed MARE motifs, by forming a heterodimer with small leucine zipper MAF proteins such as MAFK, MAFG, and MAFF. The calculated molecular weight of BACH2 is 92 kDa, but the post-modifiction of BACH2 is about 120-130 kDa. (PMID: 24277074 ) Protocols Product Specific Protocols WB protocol for BACH2 antibody 27635-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Bach2 overexpression represses Th9 cell differentiation by suppressing IRF4 expression in systemic lupus erythematosus.
Journal: FEBS Open Bio | Authors: Yujun Sheng KD Validated | Species: human | Application: WB - Extracellular vesicle-derived mir-148a-3p promotes plasmablast differentiation in bullous pemphigoid via BACH2 repression and mTOR activation.
Journal: J Invest Dermatol | Authors: Jine Zhang | Species: human - BACH2 Exacerbates Bronchopulmonary Dysplasia by Promoting NCOA4-Dependent Ferritinophagy via Transcriptional Activation of JUN.
Journal: Antioxid Redox Signal | Authors: Menghua Zhao - Prognostic value of circadian rhythm-associated genes in breast cancer
Journal: World J Surg Oncol | Authors: Ling Wang | Species: human | Application: WB,IHC - Class I HDAC inhibitors enhance antitumor efficacy and persistence of CAR-T cells by activation of the Wnt pathway
Journal: Cell Rep | Authors: Meng Zhu | Species: human | Application: WB - Zinc Protoporphyrin Functions as a Ferroptosis Inducer to Activate Heme-BACH Axis and Potently Suppress IDH1-Mutant Gliomas.
Journal: Antioxid Redox Signal | Authors: Ying Yang | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
