IRSp53 Polyclonal antibody 11087-2-AP proteintech
$149.00
In stock
SKU
11087-2-AP
| Catalog Number | 11087-2-AP |
| Synonyms | BAIAP2, BAI associated protein 2, BAI1 associated protein 2, BAI1-associated protein 2, BAI-associated protein 2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, hamster |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, hamster |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1552 Product name: Recombinant human BAIAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC014020 Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN Predict reactive species |
| Full Name | BAI1-associated protein 2 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC014020 |
| Gene Symbol | IRSp53 |
| Gene ID (NCBI) | 10458 |
| RRID | AB_2063075 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQB8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for IRSp53 antibody 11087-2-AP | Download protocol |
| IP protocol for IRSp53 antibody 11087-2-AP | Download protocol |
| WB protocol for IRSp53 antibody 11087-2-AP | Download protocol |
| mouse | IF Lab Invest FAK Signaling Induces the Onset of Proteinuria via FAK Signaling in a Mouse Model of Lung Cancer Authors - Sheng-Wen Niu View Article |
| human | WB Biochem Biophys Res Commun Role of membrane proximal actin regulators in SARS-CoV-2 spike-induced cell-cell fusion Authors - Linting Kou View Article |
| hamster | WB,IP Proteomics Proteomics Analysis Identifies IRSp53 and Fascin as Critical for PRV Egress and Direct Cell-Cell Transmission. Authors - Fei-Long Yu View Article |
| anwesh (Verified Customer) (10-28-2019) | Bands detected at the correct molecular weight. Great antibody. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: 293T, U2OS, A549 IRSp53 Antibody Western Blot, validation (1:1000 dilution) in 293T, U2OS, A549 (Cat no:11087-2-AP) |
| Citations | 12 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
IRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit/hyperactivity disorder (ADHD) (PMID: 26275848). Protocols Product Specific Protocols IHC protocol for IRSp53 antibody 11087-2-AP Download protocol IP protocol for IRSp53 antibody 11087-2-AP Download protocol WB protocol for IRSp53 antibody 11087-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Interactome network analysis identifies multiple caspase-6 interactors involved in the pathogenesis of HD.
Journal: Hum Mol Genet | Authors: Sean-Patrick Riechers | Species: mouse | Application: WB - Extracellular vesicles containing the I-BAR protein IRSp53 are released from the cell plasma membrane in an Arp2/3 dependent manner.
Journal: Biol Cell | Authors: Alice Trausch | Species: human | Application: WB - Proteomics Analysis Identifies IRSp53 and Fascin as Critical for PRV Egress and Direct Cell-Cell Transmission.
Journal: Proteomics | Authors: Fei-Long Yu | Species: hamster | Application: WB,IP - Role of membrane proximal actin regulators in SARS-CoV-2 spike-induced cell-cell fusion
Journal: Biochem Biophys Res Commun | Authors: Linting Kou | Species: human | Application: WB - Disruption of Robo2-Baiap2 integrated signaling drives cystic disease.
Journal: JCI Insight | Authors: Qinggang Li | Species: mouse | Application: WB - FAK Signaling Induces the Onset of Proteinuria via FAK Signaling in a Mouse Model of Lung Cancer
Journal: Lab Invest | Authors: Sheng-Wen Niu | Species: mouse | Application: IF - Proteomics Analysis Identifies IRSp53 and Fascin as Critical for PRV Egress and Direct Cell-Cell Transmission.
Journal: Proteomics | Authors: Fei-Long Yu | Species: hamster | Application: WB,IP - Interactome network analysis identifies multiple caspase-6 interactors involved in the pathogenesis of HD.
Journal: Hum Mol Genet | Authors: Sean-Patrick Riechers | Species: mouse | Application: WB - Extracellular vesicles containing the I-BAR protein IRSp53 are released from the cell plasma membrane in an Arp2/3 dependent manner.
Journal: Biol Cell | Authors: Alice Trausch | Species: human | Application: WB - Role of membrane proximal actin regulators in SARS-CoV-2 spike-induced cell-cell fusion
Journal: Biochem Biophys Res Commun | Authors: Linting Kou | Species: human | Application: WB - Proteomic characteristics reveal the signatures and the risks of T1 colorectal cancer metastasis to lymph nodes
Journal: Elife | Authors: Aojia Zhuang | Species: human | Application: IHC - Integrative multiomic analysis links TDP-43-driven splicing defects to cascading proteomic disruption of ALS/FTD pathways.
Journal: bioRxiv | Authors: Velina Kozareva | Species: human | Application: WB - The BAIAP2 Pathway Regulates Proliferation and Migration in Medulloblastoma.
Journal: J Biol Chem | Authors: Luz Clarita Ruiz
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
