Cryptochrome 1 Polyclonal antibody 13474-1-AP proteintech
$149.00
In stock
SKU
13474-1-AP
| Catalog Number | 13474-1-AP |
| Synonyms | CRY1, CRY 1, Cryptochrome-1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, hamster |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), CoIP, ChIP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, Y79 cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:5000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, Y79 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, hamster |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4270 Product name: Recombinant human CRY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-586 aa of BC030519 Sequence: RPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN Predict reactive species |
| Full Name | cryptochrome 1 (photolyase-like) |
| Calculated Molecular Weight | 586 aa, 66 kDa |
| Observed Molecular Weight | 60-66 kDa |
| GenBank Accession Number | BC030519 |
| Gene Symbol | CRY1 |
| Gene ID (NCBI) | 1407 |
| RRID | AB_10697652 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16526 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Cryptochrome 1 antibody 13474-1-AP | Download protocol |
| IF protocol for Cryptochrome 1 antibody 13474-1-AP | Download protocol |
| IHC protocol for Cryptochrome 1 antibody 13474-1-AP | Download protocol |
| WB protocol for Cryptochrome 1 antibody 13474-1-AP | Download protocol |
| human | WB EMBO Rep Circadian networks in human embryonic stem cell-derived cardiomyocytes. Authors - Pieterjan Dierickx View Article |
| mouse | WB Sci Total Environ Maternal circadian disruption before pregnancy impairs the ovarian function of female offspring in mice Authors - Yajie Guan View Article |
| Priya (Verified Customer) (01-11-2023) | I have used this for Human cardiomyocytes cell line and mice skin, and liver tissues Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Cardiomyoctyes, Keratinocytes, Liver and skin |
| Iru (Verified Customer) (06-26-2020) | It works fine in 1:1000. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Fallopian tube epithelial cells |
| Citations | 48 |
| Dilutions | WB : 1:1000-1:5000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Cryptochrome circadian clock 1 (CRY1) is a flavin adenine dinucleotide-binding protein with MW of 66 kDa. CRY1 is a key component of the circadian core oscillator complex, which regulates the circadian clock. CRY1 predominantly displays evening-time expression and serves as a strong repressor of morning-time elements (E box/E-prime box) when bound to the BMAL1 (ARNTL; 602550)/CLOCK (601851) complex (PubMed: 21236481). This antibody can recognize CRY1 and CRY2 due to the high homology. Protocols Product Specific Protocols FC protocol for Cryptochrome 1 antibody 13474-1-AP Download protocol IF protocol for Cryptochrome 1 antibody 13474-1-AP Download protocol IHC protocol for Cryptochrome 1 antibody 13474-1-AP Download protocol WB protocol for Cryptochrome 1 antibody 13474-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Circadian clocks are modulated by compartmentalized oscillating translation
Journal: Cell | Authors: Yanrong Zhuang | Application: WB - Mini and enhanced CRISPR activators for cancer therapies
Journal: J Adv Res | Authors: Meiyu Huang | Species: human | Application: WB - Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario
Journal: Sci Total Environ | Authors: Fangnon Firmin Fangninou | Application: WB - Maternal circadian disruption before pregnancy impairs the ovarian function of female offspring in mice
Journal: Sci Total Environ | Authors: Yajie Guan | Species: mouse | Application: WB - Development of human cartilage circadian rhythm in a stem cell-chondrogenesis model.
Journal: Theranostics | Authors: Mark A Naven | Species: human | Application: IF - Circadian networks in human embryonic stem cell-derived cardiomyocytes.
Journal: EMBO Rep | Authors: Pieterjan Dierickx | Species: human | Application: WB - Disruption of local circadian clocks in aristolochic acid-induced nephropathy in mice
Journal: Phytomedicine | Authors: Dihao Xie | Species: mouse | Application: WB - Neuro-skeletal crosstalk: Brain-derived 5-HT mediates the bone-protective effects of β-Sitosterol against postmenopausal osteoporosis.
Journal: Phytomedicine | Authors: Kaixuan Wang | Species: mouse | Application: WB - Maternal circadian disruption before pregnancy impairs the ovarian function of female offspring in mice
Journal: Sci Total Environ | Authors: Yajie Guan | Species: mouse | Application: WB - Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario
Journal: Sci Total Environ | Authors: Fangnon Firmin Fangninou | Application: WB - Magnetogenetics inspired by animal Magnetoreception: ΔTRPV4MagR as a novel magnetogenetic actuator enabling remote neuromodulation of brain circuits
Journal: Brain Stimul | Authors: Meng-Nan Liu | Application: WB - Cryptochrome 1 regulates ovarian granulosa cell senescence through NCOA4-mediated ferritinophagy
Journal: Free Radic Biol Med | Authors: Jing Ma | Species: human | Application: WB,IF - Hydrogen peroxide modulates clock gene expression via PRX2-STAT3-REV-ERBα/β pathway.
Journal: Free Radic Biol Med | Authors: Guohua Ji | Species: mouse | Application: WB - Disrupted riboflavin metabolism impairs circadian rhythm in ovarian granulosa cells: a novel mechanism driving DOR.
Journal: Free Radic Biol Med | Authors: Yao Peng | Species: rat,human | Application: IF - Melatonin alleviates depression-like behaviors and cognitive dysfunction in mice by regulating the circadian rhythm of AQP4 polarization
Journal: Transl Psychiatry | Authors: Di Yao | Species: mouse | Application: WB - Interaction of Bmal1 and eIF2α/ATF4 pathway was involved in Shuxie compound alleviation of circadian rhythm disturbance-induced hepatic endoplasmic reticulum stress
Journal: J Ethnopharmacol | Authors: Mengting Zhang | Species: human | Application: WB - Capsaicin Attenuates Oleic Acid-Induced Lipid Accumulation via the Regulation of Circadian Clock Genes in HepG2 Cells.
Journal: J Agric Food Chem | Authors: Run Li | Species: human | Application: WB - Ganoderic Acid A Mitigates Sleep Deprivation-Induced Behavioral Deficits and Aging-like Phenotypes by Cryptochrome 1-Mediated Suppression of Ferroptosis and Pyroptosis.
Journal: J Agric Food Chem | Authors: Yuchen Ma | Species: mouse | Application: WB - Exploration of the mechanism underlying the impact of artificial light on guinea pig ovarian function via proteomics and acetylation analyses
Journal: Ecotoxicol Environ Saf | Authors: Jiayu Shi - CRY1/2 regulate rhythmic CYP2A5 in mouse liver through repression of E4BP4
Journal: Biochem Pharmacol | Authors: Luomin Lin | Species: mouse,human | Application: WB,CoIP - Melatonin regulates the immune response and improves Sjögren's syndrome-like symptoms in NOD/Ltj Mice.
Journal: Biochem Pharmacol | Authors: Yi Liu | Species: mouse | Application: WB - Age-dependent effects of a high-fat diet combined with dietary advanced glycation end products on cognitive function and protection with voluntary exercise.
Journal: Food Funct | Authors: Lan Luo | Species: mouse | Application: WB - Circadian networks in human embryonic stem cell-derived cardiomyocytes.
Journal: EMBO Rep | Authors: Pieterjan Dierickx | Species: human | Application: WB - ZFP42 maintains stemness and rhythmic transcription in human epidermal stem and progenitor cells via CRY1.
Journal: Commun Biol | Authors: Shuiying Gao | Species: human | Application: WB,ChIP - HlncRNA-1 integrates the hepatic circadian clock with lipid metabolism by targeting Hdlbp.
Journal: Commun Biol | Authors: Chen Sun | Species: mouse | Application: WB - Alleviative effects of the parthenolide derivative ACT001 on insulin resistance induced by sodium propionate combined with a high-fat diet and its potential mechanisms
Journal: Eur J Pharmacol | Authors: Qian Yu | Species: mouse | Application: WB - SCA1(+) Cells from the Heart Possess a Molecular Circadian Clock and Display Circadian Oscillations in Cellular Functions.
Journal: Stem Cell Reports | Authors: Bastiaan C Du Pré | Species: human | Application: WB - Circadian Disruption Is Associated with Elevated Whole-Semen mtDNA Copy Number and Implicates CRY1 as a Candidate Regulator in Humans and Mice.
Journal: Int J Mol Sci | Authors: Mengchao He - Dark-light cycle disrupts bone metabolism and suppresses joint deterioration in osteoarthritic rats.
Journal: Arthritis Res Ther | Authors: Xiaopeng Song | Species: rat | Application: WB - Dynamic and functional analyses of exosomal miRNAs regulating cellular microenvironment of ovarian cancer cells
Journal: J Ovarian Res | Authors: Zhaoxia Wang | Species: human | Application: WB - Time-of-day-dependent effects of exercise on the hepatic clock and proteome in high-fat diet-fed mice.
Journal: J Physiol Biochem | Authors: Chunxiu Huang | Species: mouse | Application: WB - Quercetin improved hepatic circadian rhythm dysfunction in middle-aged mice fed with vitamin D-deficient diet
Journal: J Physiol Biochem | Authors: Rui Li | Species: mouse | Application: WB - EZH2 expression in hepatocellular carcinoma and its relationship with circadian rhythm-related genes.
Journal: Sci Rep | Authors: Xingyue Wang | Species: human | Application: WB - Involvement of circadian clock protein PER2 in controlling sleep deprivation induced HMGB1 up-regulation by targeting p300 in the cortex
Journal: Sci Rep | Authors: Min Zhang | Species: rat | Application: WB - Sleep Fragmentation, Electroencephalographic Slowing, and Circadian Disarray in a Mouse Model for Intensive Care Unit Delirium
Journal: Anesth Analg | Authors: Elzbieta Dulko | Species: mouse | Application: WB - Circadian Clock Dysfunction Exacerbate Autistic-Like Behaviour and Wnt/β-Catenin Signalling Dysregulation in ASD Mice and Treatment of Melatonin.
Journal: J Cell Mol Med | Authors: Yuxing Zhang | Species: mouse | Application: WB - Sulforaphane Improves Liver Metabolism and Gut Microbiota in Circadian Rhythm Disorder Mice Models Fed With High-Fat Diets
Journal: Mol Nutr Food Res | Authors: Canxia He | Species: mouse | Application: WB - Loss of ARNTL Enhances ER Stress and Apoptosis in CKD Through Disruption of NRF2 Signaling
Journal: FASEB J | Authors: Li He | Species: mouse,human | Application: WB,IHC - Time-Restricted Feeding Affects Energy Metabolism in Lactating Striped Hamsters (Cricetulus barabensis, Cricetidae, Rodentia).
Journal: Biology (Basel) | Authors: Wenting Li | Species: hamster | Application: WB - Rhythmic expression of miR-27b-3p targets the clock gene Bmal1 at the posttranscriptional level in the mouse liver.
Journal: FASEB J | Authors: Wenxiang Zhang | Species: mouse | Application: WB - Acute hypoxia induced dysregulation of clock-controlled ovary functions
Journal: Front Physiol | Authors: Mengnan Ding | Species: mouse | Application: WB - Decreased Memory and Learning Ability Mediated by Bmal1/M1 Macrophages/Angptl2/Inflammatory Cytokine Pathway in Mice Exposed to Long-Term Blue Light Irradiation
Journal: Curr Issues Mol Biol | Authors: Keiichi Hiramoto | Species: mouse | Application: WB - Decreased expression of the clock gene Bmal1 is involved in the pathogenesis of temporal lobe epilepsy.
Journal: Mol Brain | Authors: Hao Wu | Species: mouse | Application: WB - Effect of Jiaotai Pill () on intestinal damage in partially sleep deprived rats.
Journal: Chin J Integr Med | Authors: Wen-Ya Huang | Species: rat | Application: WB - Bromide impairs the circadian clock and glycolytic homeostasis via disruption of autophagy in rat H9C2 cardiomyocytes.
Journal: BMC Mol Cell Biol | Authors: Yicheng Jiang | Species: rat | Application: WB - Time of day differences in the regulation of glutathione levels in the rat lens
Journal: Front Ophthalmol (Lausanne) | Authors: Bo Li | Species: rat | Application: WB - Jiao-tai-wan Up-regulates Hypothalamic and Peripheral Circadian Clock Gene Cryptochrome and Activates PI3K/AKT Signaling in Partially Sleep-deprived Rats.
Journal: Curr Med Sci | Authors: Wen-Ya Huang | Species: mouse | Application: WB - Subtype-specific circadian clock dysregulation modulates breast cancer biology, invasiveness, and prognosis
Journal: bioRxiv | Authors: Jan A Hammarlund | Species: human | Application: WB - E4BP4 interacts with PERK to form a feedback loop mediating cold-induced female reproductive disorders.
Journal: Cell Stress Chaperones | Authors: Yumeng Miao
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
