BMPR1A Polyclonal antibody 12702-1-AP proteintech
$149.00
In stock
SKU
12702-1-AP
| Catalog Number | 12702-1-AP |
| Synonyms | Activin receptor like kinase 3, Activin receptor-like kinase 3, ACVRLK3, ALK 3, ALK3 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HEK-293 cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse liver tissue, Jurkat cells, K-562 cells, U2OS cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, U2OS cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells, HEK-293 cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse liver tissue, Jurkat cells, K-562 cells, U2OS cells |
| Positive IP detected in | HEK-293 cells |
| Positive IF/ICC detected in | HeLa cells, U2OS cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3410 Product name: Recombinant human BMPR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-427 aa of BC028383 Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM Predict reactive species |
| Full Name | bone morphogenetic protein receptor, type IA |
| Calculated Molecular Weight | 532 aa, 60 kDa |
| Observed Molecular Weight | 60-68 kDa |
| GenBank Accession Number | BC028383 |
| Gene Symbol | BMPR1A |
| Gene ID (NCBI) | 657 |
| RRID | AB_2064273 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36894 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for BMPR1A antibody 12702-1-AP | Download protocol |
| IP protocol for BMPR1A antibody 12702-1-AP | Download protocol |
| WB protocol for BMPR1A antibody 12702-1-AP | Download protocol |
| human | WB Biochim Biophys Acta Gen Subj Expression of GALNT8 and O-glycosylation of BMP receptor 1A suppress breast cancer cell proliferation by upregulating ERα levels Authors - Tianmiao Huang View Article |
| mouse | WB PLoS One Effect of miR-20b on Apoptosis, Differentiation, the BMP Signaling Pathway and Mitochondrial Function in the P19 Cell Model of Cardiac Differentiation In Vitro. Authors - Shasha Zhu View Article |
| rat | WB Sci Rep Hypoxia inducible factor-1 mediates expression of miR-322: potential role in proliferation and migration of pulmonary arterial smooth muscle cells. Authors - Yan Zeng View Article |
| Citations | 20 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- A PINCH-1-Smurf1 signaling axis mediates mechano-regulation of BMPR2 and stem cell differentiation.
Journal: J Cell Biol | Authors: Ling Guo | Species: human | Application: WB - Reverse signaling by semaphorin 4C elicits SMAD1/5- and ID1/3-dependent invasive reprogramming in cancer cells.
Journal: Sci Signal | Authors: Sreeharsha Gurrapu | Species: human | Application: IP - Hormone-Responsive BMP Signaling Expands Myoepithelial Cell Lineages and Prevents Alveolar Precocity in Mammary Gland.
Journal: Front Cell Dev Biol | Authors: Chunlei Shao | Species: mouse | Application: WB,IF - Effect of miR-20b on Apoptosis, Differentiation, the BMP Signaling Pathway and Mitochondrial Function in the P19 Cell Model of Cardiac Differentiation In Vitro.
Journal: PLoS One | Authors: Shasha Zhu | Species: mouse | Application: WB - Expression of GALNT8 and O-glycosylation of BMP receptor 1A suppress breast cancer cell proliferation by upregulating ERα levels
Journal: Biochim Biophys Acta Gen Subj | Authors: Tianmiao Huang | Species: human | Application: WB - Hypoxia inducible factor-1 mediates expression of miR-322: potential role in proliferation and migration of pulmonary arterial smooth muscle cells.
Journal: Sci Rep | Authors: Yan Zeng | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
