BNIP3 Recombinant monoclonal antibody, PBS Only (Capture) 86909-2-PBS proteintech
$699.00
In stock
SKU
86909-2-PBS
| Catalog Number | 86909-2-PBS |
| Synonyms | NIP3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag19747 Product name: Recombinant human BNIP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-121 aa of BC009342 Sequence: PRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWS Predict reactive species |
| Full Name | BCL2/adenovirus E1B 19kDa interacting protein 3 |
| Calculated Molecular Weight | 194 aa, 22 kDa |
| GenBank Accession Number | BC009342 |
| Gene Symbol | BNIP3 |
| Gene ID (NCBI) | 664 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12983 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251462C9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
