ZC3HAV1 Polyclonal antibody 16820-1-AP proteintech
$149.00
In stock
SKU
16820-1-AP
| Catalog Number | 16820-1-AP |
| Synonyms | ADP-ribosyltransferase diphtheria toxin-like 13, ARTD13, Inactive Poly [ADP-ribose] polymerase 13, PARP13, PRO1677 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, RIP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag10364 Product name: Recombinant human ZC3HAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC025308 Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS Predict reactive species |
| Full Name | zinc finger CCCH-type, antiviral 1 |
| Calculated Molecular Weight | 699aa,78 kDa; 902aa,101 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC025308 |
| Gene Symbol | ZC3HAV1 |
| Gene ID (NCBI) | 56829 |
| RRID | AB_2728733 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z2W4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ZC3HAV1 antibody 16820-1-AP | Download protocol |
| IP protocol for ZC3HAV1 antibody 16820-1-AP | Download protocol |
| WB protocol for ZC3HAV1 antibody 16820-1-AP | Download protocol |
| human | WB Nucleic Acids Res Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. Authors - Evan P Booy View Article |
| Sven (Verified Customer) (08-05-2025) | I used the AB for WB, it worked very well. Applications: Western Blot Primary Antibody Dilution: 1/6000 Cell Tissue Type: HEK-293 |
| Lisa (Verified Customer) (08-05-2025) | Works perfectly for WB even highly diluted um to 1:20000 Applications: Western Blot Primary Antibody Dilution: 1:6000 Cell Tissue Type: HEK293, U2OS |
| Saul (Verified Customer) (07-23-2025) | really nice sharp signal even at quite high dilution Applications: Western Blot Primary Antibody Dilution: 1.6000 Cell Tissue Type: U2OS cell line |
| Daniel (Verified Customer) (10-26-2022) | This is a fantastic antibody. It works very reliably at high dilutions. Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: HEK293T, HELA, MT4, SupT1 ZC3HAV1 Antibody Western Blot validation (1:5000 dilution) in HEK293T, HELA, MT4, SupT1 (Cat no:16820-1-AP) |
| Citations | 38 |
| Dilutions | WB : 1:2000-1:12000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms. ZC3HAV1 exists some isoforms with MV 101, 77, 67, 42 and 18 kDa. Protocols Product Specific Protocols IHC protocol for ZC3HAV1 antibody 16820-1-AP Download protocol IP protocol for ZC3HAV1 antibody 16820-1-AP Download protocol WB protocol for ZC3HAV1 antibody 16820-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- CG dinucleotide suppression enables antiviral defence targeting non-self RNA.
Journal: Nature | Authors: Matthew A Takata KD Validated | Species: human | Application: WB - SCAF4 and SCAF8, mRNA Anti-Terminator Proteins.
Journal: Cell | Authors: Lea H Gregersen | Species: human | Application: WB - HIV-1 matrix-tRNA complex structure reveals basis for host control of Gag localization.
Journal: Cell Host Microbe | Authors: Charles Bou-Nader - Rational attenuation of RNA viruses with zinc finger antiviral protein
Journal: Nat Microbiol | Authors: Daniel Gonçalves-Carneiro | Species: human | Application: WB - The short isoform of the host antiviral protein ZAP acts as an inhibitor of SARS-CoV-2 programmed ribosomal frameshifting.
Journal: Nat Commun | Authors: Matthias M Zimmer | Species: human | Application: WB,IP - Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.
Journal: Nucleic Acids Res | Authors: Evan P Booy | Species: human | Application: WB
Reviews
Write Your Own Review